Animal-Genome cDNA OVRM1_0158_D08


Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= OVRM1_0158_D08
         (1501 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_776711.1| cAMP responsive element binding protein 3 (luma...   437   e-122
Alignment   gi|XP_885877.1| PREDICTED: similar to cAMP responsive element b...    99   6e-21
Alignment   gi|XP_608017.2| PREDICTED: similar to cAMP responsive element b...    99   6e-21
Alignment   gi|NP_001029604.1| cAMP responsive element binding protein 3-li...    86   1e-16
Alignment   gi|XP_590741.2| PREDICTED: similar to cAMP responsive element b...    67   3e-11

>ref|NP_776711.1| cAMP responsive element binding protein 3 (luman) [Bos taurus]
          Length = 365

 Score =  437 bits (1123), Expect = e-122
 Identities = 235/341 (68%), Positives = 249/341 (73%)
 Frame = +1

Query: 190  AARDEALEAPLDWELPLSEALSDWDVEDFLSCLSSPPASLTDFSHSDPYLVHHDHTYSLS 369
            AA DEAL +P DWELPLSE+LSDWDVEDFLSCL SPPA L  FS+SDP LV HDHTYSLS
Sbjct: 25   AAPDEALTSPPDWELPLSESLSDWDVEDFLSCLPSPPAVLNVFSNSDPCLVQHDHTYSLS 84

Query: 370  QEYVSIDLDNEDYEKEGARMTSLRVEAPAEQEIGXXXXXXXXXXXXXXXXXXXXXXXXXX 549
            QE+VSIDLDNE YEKE A+MT LRVE PA+QEI                           
Sbjct: 85   QEHVSIDLDNESYEKERAQMTPLRVEEPADQEIARLILTEEEKRLLEKEGLTLPGMLPLT 144

Query: 550  RMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 729
            +MEEQVL+RVRRKIRNKKSAQESRRKKKVYVG LESRVLKY+AQNLELQNKVQLLEEQN 
Sbjct: 145  KMEEQVLKRVRRKIRNKKSAQESRRKKKVYVGGLESRVLKYTAQNLELQNKVQLLEEQNL 204

Query: 730  XXXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAMYSSDTRGSPPAEHGVLSR 909
                       MVIQTANKASSSSTC+            PAMYSSDTRGS PAEH VLSR
Sbjct: 205  SLLDQLRRLQAMVIQTANKASSSSTCVLVLLFSFCLLLVPAMYSSDTRGSLPAEHRVLSR 264

Query: 910  QLRALPSEDVPQRDLPALQSEVPQDSSTHELQAPGNSCCLFHHMAWAPGAESPMKLPLPD 1089
            QLRALPSED PQ + PALQSEVP+DS   ELQA  NSCCLFH M  AP AE P++LPLPD
Sbjct: 265  QLRALPSEDPPQLEPPALQSEVPKDSLNPELQAASNSCCLFHLMPQAPRAEPPLQLPLPD 324

Query: 1090 RFSRSSSPGPIFPLHANLTREGGWPPTHSPISVTLQGRYSG 1212
             FS  S P  I PLHANLTRE GW PT SP SV LQGRYSG
Sbjct: 325  GFSGCSCPDSISPLHANLTREEGWLPTPSPTSVILQGRYSG 365


>ref|XP_885877.1| PREDICTED: similar to cAMP responsive element binding protein
           3-like 4 isoform 2 [Bos taurus]
          Length = 257

 Score = 99.0 bits (245), Expect(2) = 6e-21
 Identities = 56/128 (43%), Positives = 76/128 (59%), Gaps = 6/128 (4%)
 Frame = +1

Query: 550 RMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 729
           + EE+VL++VRRKIRNK+SAQ+SRR+KK Y+  LESRV   +AQN ELQ KVQ LE  N 
Sbjct: 74  KAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACAAQNQELQRKVQELERHNI 133

Query: 730 XXXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAMYSSDTRGSPPA------E 891
                      +++QT+NKA+ +STC+            P+   S  +G P A       
Sbjct: 134 SLVTQLRQLQMLIVQTSNKAAQTSTCVLILLFSLALIILPSF--SPFQGLPEAGPEDYQP 191

Query: 892 HGVLSRQL 915
           HGV+SR +
Sbjct: 192 HGVISRNI 199



 Score = 21.2 bits (43), Expect(2) = 6e-21
 Identities = 13/44 (29%), Positives = 15/44 (34%)
 Frame = +3

Query: 1035 PHGLGSWGRIAHEAATARPLLKVF*PRSHLPPACKSHKRGRMAP 1166
            PHG+ S   + H   T  P   V   R   PP  K        P
Sbjct: 191  PHGVISRNILTHRDMTENPENAVEESRLEGPPGAKGANSSTRTP 234


>ref|XP_608017.2| PREDICTED: similar to cAMP responsive element binding protein
           3-like 4 isoform 1 [Bos taurus]
          Length = 257

 Score = 99.0 bits (245), Expect(2) = 6e-21
 Identities = 56/128 (43%), Positives = 76/128 (59%), Gaps = 6/128 (4%)
 Frame = +1

Query: 550 RMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 729
           + EE+VL++VRRKIRNK+SAQ+SRR+KK Y+  LESRV   +AQN ELQ KVQ LE  N 
Sbjct: 74  KAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACAAQNQELQRKVQELERHNI 133

Query: 730 XXXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAMYSSDTRGSPPA------E 891
                      +++QT+NKA+ +STC+            P+   S  +G P A       
Sbjct: 134 SLVTQLRQLQMLIVQTSNKAAQTSTCVLILLFSLALIILPSF--SPFQGLPEAGPEDYQP 191

Query: 892 HGVLSRQL 915
           HGV+SR +
Sbjct: 192 HGVISRNI 199



 Score = 21.2 bits (43), Expect(2) = 6e-21
 Identities = 13/44 (29%), Positives = 15/44 (34%)
 Frame = +3

Query: 1035 PHGLGSWGRIAHEAATARPLLKVF*PRSHLPPACKSHKRGRMAP 1166
            PHG+ S   + H   T  P   V   R   PP  K        P
Sbjct: 191  PHGVISRNILTHRDMTENPENAVEESRLEGPPGAKGANSSTRTP 234


>ref|NP_001029604.1| cAMP responsive element binding protein 3-like 3 [Bos taurus]
          Length = 456

 Score = 85.5 bits (210), Expect = 1e-16
 Identities = 55/161 (34%), Positives = 89/161 (55%), Gaps = 5/161 (3%)
 Frame = +1

Query: 550  RMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 729
            + EE++L+++RRKIRNK+SAQESR+KKK Y+  LE+R+   +AQN ELQ KV  LE+QN 
Sbjct: 233  KYEERMLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNL 292

Query: 730  XXXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAM--YSSDTRGSPP--AEHG 897
                       +V+Q+ +K++ + TCI            P++  ++S+   SP   A   
Sbjct: 293  SLLEQLKKLQAIVVQSTSKSAQTGTCIAVLLFSFALIVLPSISPFASNRAESPGDFAPVR 352

Query: 898  VLSRQLRALPSEDVPQRDLPALQSEVP-QDSSTHELQAPGN 1017
            V SR L    +  V     P  ++  P  ++   + ++PG+
Sbjct: 353  VFSRTLHNDAASRVAPDTAPGSEAPGPGPNTGALQERSPGS 393


>ref|XP_590741.2| PREDICTED: similar to cAMP responsive element binding protein
           3-like 1 [Bos taurus]
          Length = 520

 Score = 67.4 bits (163), Expect = 3e-11
 Identities = 38/92 (41%), Positives = 54/92 (58%), Gaps = 5/92 (5%)
 Frame = +1

Query: 550 RMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 729
           + EE+ L+RVRRKI+NK SAQESRRKKK YV  LE +V  ++++N EL  KV+ LE  N 
Sbjct: 285 KAEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANR 344

Query: 730 XXXXXXXXXXXMVIQTANK-----ASSSSTCI 810
                      +V    ++     A+ + TC+
Sbjct: 345 TLLQQLQKLQTLVTSKISRPYKMAATQTGTCL 376


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 54,944,624
Number of Sequences: 33508
Number of extensions: 1613735
Number of successful extensions: 7965
Number of sequences better than 1.0e-05: 5
Number of HSP's better than  0.0 without gapping: 5770
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7924
length of database: 16,112,626
effective HSP length: 106
effective length of database: 12,560,778
effective search space used: 4936385754
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= OVRM1_0158_D08
         (1501 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_854750.1| PREDICTED: similar to cAMP responsive element b...   397   e-110
Alignment   gi|XP_855139.1| PREDICTED: similar to cAMP responsive element b...    96   9e-20
Alignment   gi|XP_542164.2| PREDICTED: similar to cAMP responsive element b...    86   7e-17
Alignment   gi|XP_548490.2| PREDICTED: similar to cAMP responsive element b...    70   4e-12
Alignment   gi|XP_540756.2| PREDICTED: similar to cAMP responsive element b...    67   4e-11

>ref|XP_854750.1| PREDICTED: similar to cAMP responsive element binding protein 3
            [Canis familiaris]
          Length = 411

 Score =  397 bits (1020), Expect = e-110
 Identities = 210/326 (64%), Positives = 232/326 (71%)
 Frame = +1

Query: 235  PLSEALSDWDVEDFLSCLSSPPASLTDFSHSDPYLVHHDHTYSLSQEYVSIDLDNEDYEK 414
            PLSEALS+W+ EDFLS + SPPASL   S SD  LVHHDHTYSLSQ++VSIDLD   Y K
Sbjct: 86   PLSEALSEWEAEDFLSSMLSPPASLNVLSSSDSCLVHHDHTYSLSQQHVSIDLDGGSYGK 145

Query: 415  EGARMTSLRVEAPAEQEIGXXXXXXXXXXXXXXXXXXXXXXXXXXRMEEQVLRRVRRKIR 594
            E A+ T L+VE PAEQEI                           +MEEQVL RVRRKIR
Sbjct: 146  EEAQTTPLQVEEPAEQEIARLILTDEEKRLLEKEGLTLHGTLPLTKMEEQVLTRVRRKIR 205

Query: 595  NKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNXXXXXXXXXXXXMVIQ 774
            NKKSAQESRRKKKVY+G LE+RVLKY+AQNLELQNKVQLLEEQN            M+IQ
Sbjct: 206  NKKSAQESRRKKKVYLGGLENRVLKYTAQNLELQNKVQLLEEQNLSLLDQLRRLQAMLIQ 265

Query: 775  TANKASSSSTCIXXXXXXXXXXXXPAMYSSDTRGSPPAEHGVLSRQLRALPSEDVPQRDL 954
             +NK SSSSTC+            PAMYSSDTRGS PAEHGVLSRQLRALPSED  Q +L
Sbjct: 266  ISNKTSSSSTCVLVLLFSFCLLIVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPHQLEL 325

Query: 955  PALQSEVPQDSSTHELQAPGNSCCLFHHMAWAPGAESPMKLPLPDRFSRSSSPGPIFPLH 1134
            PALQSEVP+DSS  ELQAPGNSCC  +H+  APGAESP+KLPLP   S+S    P+ PLH
Sbjct: 326  PALQSEVPKDSSDQELQAPGNSCCPLYHLPQAPGAESPLKLPLPVPSSKSPCSCPLLPLH 385

Query: 1135 ANLTREGGWPPTHSPISVTLQGRYSG 1212
            AN TR+GGW PTHSP SV LQGRYSG
Sbjct: 386  ANFTRDGGWLPTHSPTSVILQGRYSG 411


>ref|XP_855139.1| PREDICTED: similar to cAMP responsive element binding protein
           3-like 4 [Canis familiaris]
          Length = 384

 Score = 95.9 bits (237), Expect = 9e-20
 Identities = 55/128 (42%), Positives = 75/128 (58%), Gaps = 6/128 (4%)
 Frame = +1

Query: 550 RMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 729
           + EE+VL+++RRKIRNK+SAQ+SRR+KK Y+  LESRV   SAQN ELQ KVQ LE  N 
Sbjct: 201 KAEERVLKKIRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSAQNQELQKKVQELERHNI 260

Query: 730 XXXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAMYSSDTRGSPPA------E 891
                      ++ QT+NKA+ +STC+            P++  S  +G   A       
Sbjct: 261 SLVTQLRQLQTLIAQTSNKAAQTSTCVLILLFSLALIVLPSV--SPLQGLREAGSEDYQP 318

Query: 892 HGVLSRQL 915
           HGV+SR +
Sbjct: 319 HGVISRNI 326


>ref|XP_542164.2| PREDICTED: similar to cAMP responsive element binding protein 3-like
            3 [Canis familiaris]
          Length = 609

 Score = 86.3 bits (212), Expect = 7e-17
 Identities = 54/161 (33%), Positives = 85/161 (52%), Gaps = 5/161 (3%)
 Frame = +1

Query: 550  RMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 729
            + EE+VL+++RRKIRNK+SAQESR+KKK Y+  LE+R+   +AQN ELQ KV  LE+QN 
Sbjct: 358  KYEERVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNL 417

Query: 730  XXXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPA----MYSSDTRGSPPAEHG 897
                       +V+Q+ +K++ + TC+            P+    + +        A   
Sbjct: 418  SLLEQLKKLQAIVVQSTSKSAQTGTCLAVLLFSFALIVLPSISPFVANKAKHAGDYAPVR 477

Query: 898  VLSRQLRALPSEDVPQRDLPALQSEVPQ-DSSTHELQAPGN 1017
            V SR L   P+  V    +P  ++  P+    T +  +PG+
Sbjct: 478  VFSRTLHNDPASRVAPDAIPGSEAPGPRPKGGTPQEGSPGS 518


>ref|XP_548490.2| PREDICTED: similar to cAMP responsive element binding protein
           3-like 2 [Canis familiaris]
          Length = 393

 Score = 70.5 bits (171), Expect = 4e-12
 Identities = 43/127 (33%), Positives = 66/127 (51%), Gaps = 10/127 (7%)
 Frame = +1

Query: 550 RMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 729
           + EE+ L+++RRKI+NK SAQESRRKKK Y+ SLE +V   S +NLEL+ KV++LE  N 
Sbjct: 186 KSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNR 245

Query: 730 XXXXXXXXXXXMVIQTANK-----ASSSSTCIX-----XXXXXXXXXXXPAMYSSDTRGS 879
                      +V+   ++      + + TC+                    Y S T+ +
Sbjct: 246 TLLQQLQKLQTLVMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMA 305

Query: 880 PPAEHGV 900
            P++H V
Sbjct: 306 LPSQHSV 312


>ref|XP_540756.2| PREDICTED: similar to cAMP responsive element binding protein
           3-like 1 [Canis familiaris]
          Length = 725

 Score = 67.4 bits (163), Expect = 4e-11
 Identities = 38/92 (41%), Positives = 54/92 (58%), Gaps = 5/92 (5%)
 Frame = +1

Query: 550 RMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 729
           + EE+ L+RVRRKI+NK SAQESRRKKK YV  LE +V  ++++N EL  KV+ LE  N 
Sbjct: 490 KAEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANR 549

Query: 730 XXXXXXXXXXXMVIQTANK-----ASSSSTCI 810
                      +V    ++     A+ + TC+
Sbjct: 550 TLLQQLQKLQTLVTNKISRPYKMAATQTGTCL 581


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 64,361,741
Number of Sequences: 33732
Number of extensions: 1900441
Number of successful extensions: 9686
Number of sequences better than 1.0e-05: 5
Number of HSP's better than  0.0 without gapping: 6870
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9591
length of database: 19,266,565
effective HSP length: 107
effective length of database: 15,657,241
effective search space used: 6137638472
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= OVRM1_0158_D08
         (1501 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_006359.3| cAMP responsive element binding protein 3 [Homo...   376   e-104
Alignment   gi|NP_570968.1| cAMP responsive element binding protein 3-like ...    99   9e-21
Alignment   gi|NP_115996.1| cAMP responsive element binding protein 3-like ...    87   3e-17
Alignment   gi|NP_919047.2| cAMP responsive element binding protein 3-like ...    70   5e-12
Alignment   gi|NP_443086.1| cAMP responsive element binding protein 3-like ...    67   3e-11

>ref|NP_006359.3| cAMP responsive element binding protein 3 [Homo sapiens]
          Length = 371

 Score =  376 bits (965), Expect = e-104
 Identities = 208/348 (59%), Positives = 234/348 (67%), Gaps = 8/348 (2%)
 Frame = +1

Query: 193  ARDEALEAPLDWELPLSEALSDWDVEDFLSCLSSPPASLTDFSHSDPYLVHHDHTYSLSQ 372
            A DEA+ APLDW LPLSE  SDW+V+D L  L SPPASL   S S+P LVHHDHTYSL +
Sbjct: 26   APDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPR 85

Query: 373  EYVSIDLDNEDYEKEGARMTSLRVEAPAEQEIGXXXXXXXXXXXXXXXXXXXXXXXXXXR 552
            E VS+DL++E   KEG +MT   +E  AEQEI                           +
Sbjct: 86   ETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTK 145

Query: 553  MEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNXX 732
             EEQ+L+RVRRKIRNK+SAQESRRKKKVYVG LESRVLKY+AQN+ELQNKVQLLEEQN  
Sbjct: 146  TEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLS 205

Query: 733  XXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAMYSSDTRGSPPAEHGVLSRQ 912
                      MVI+ +NK SSSSTCI            PAMYSSDTRGS PAEHGVLSRQ
Sbjct: 206  LLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSDTRGSLPAEHGVLSRQ 265

Query: 913  LRALPSEDVPQRDLPALQSEVPQDSSTHE--------LQAPGNSCCLFHHMAWAPGAESP 1068
            LRALPSED  Q +LPALQSEVP+D STH+        LQAPGN+ CL H+M  AP AE P
Sbjct: 266  LRALPSEDPYQLELPALQSEVPKD-STHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPP 324

Query: 1069 MKLPLPDRFSRSSSPGPIFPLHANLTREGGWPPTHSPISVTLQGRYSG 1212
            ++ P PD FS     GPI PL ANLTR+GGW PT SP SV LQ RYSG
Sbjct: 325  LEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSP-SVILQDRYSG 371


>ref|NP_570968.1| cAMP responsive element binding protein 3-like 4 [Homo sapiens]
          Length = 395

 Score = 99.0 bits (245), Expect = 9e-21
 Identities = 58/136 (42%), Positives = 78/136 (57%), Gaps = 4/136 (2%)
 Frame = +1

Query: 550 RMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 729
           + EE+VL++VRRKIRNK+SAQ+SRR+KK Y+  LESRV   SAQN ELQ KVQ LE  N 
Sbjct: 212 KAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSAQNQELQKKVQELERHNI 271

Query: 730 XXXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAMYSSDTRGSPPAE----HG 897
                      ++ QT+NKA+ +STC+            P+     +R    +E    HG
Sbjct: 272 SLVAQLRQLQTLIAQTSNKAAQTSTCVLILLFSLALIILPSFSPFQSRPEAGSEDYQPHG 331

Query: 898 VLSRQLRALPSEDVPQ 945
           V SR +  L  +DV +
Sbjct: 332 VTSRNI--LTHKDVTE 345


>ref|NP_115996.1| cAMP responsive element binding protein 3-like 3 [Homo sapiens]
          Length = 461

 Score = 87.4 bits (215), Expect = 3e-17
 Identities = 55/161 (34%), Positives = 89/161 (55%), Gaps = 5/161 (3%)
 Frame = +1

Query: 550  RMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 729
            + EE+VL+++RRKIRNK+SAQESR+KKK Y+  LE+R+   +AQN ELQ KV  LE+QN 
Sbjct: 238  KYEERVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNL 297

Query: 730  XXXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAM--YSSDTRGSPP--AEHG 897
                       +V+Q+ +K++ + TC+            P++  +  +   SP   A   
Sbjct: 298  SLLEQLKKLQAIVVQSTSKSAQTGTCVAVLLLSFALIILPSISPFGPNKTESPGDFAPVR 357

Query: 898  VLSRQLRALPSEDVPQRDLPALQSEVPQ-DSSTHELQAPGN 1017
            V SR L    +  V    +P  ++  P+ ++ T   ++PG+
Sbjct: 358  VFSRTLHNDAASRVAADAVPGSEAPGPRPEADTTREESPGS 398


>ref|NP_919047.2| cAMP responsive element binding protein 3-like 2 [Homo sapiens]
          Length = 520

 Score = 70.1 bits (170), Expect = 5e-12
 Identities = 34/59 (57%), Positives = 46/59 (77%)
 Frame = +1

Query: 550 RMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQN 726
           + EE+ L+++RRKI+NK SAQESRRKKK Y+ SLE +V   S +NLEL+ KV++LE  N
Sbjct: 289 KSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTN 347


>ref|NP_443086.1| cAMP responsive element binding protein 3-like 1 [Homo sapiens]
          Length = 519

 Score = 67.4 bits (163), Expect = 3e-11
 Identities = 38/92 (41%), Positives = 54/92 (58%), Gaps = 5/92 (5%)
 Frame = +1

Query: 550 RMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 729
           + EE+ L+RVRRKI+NK SAQESRRKKK YV  LE +V  ++++N EL  KV+ LE  N 
Sbjct: 285 KAEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANR 344

Query: 730 XXXXXXXXXXXMVIQTANK-----ASSSSTCI 810
                      +V    ++     A+ + TC+
Sbjct: 345 TLLQQLQKLQTLVTNKISRPYKMAATQTGTCL 376


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 62,868,313
Number of Sequences: 39411
Number of extensions: 1926592
Number of successful extensions: 10427
Number of sequences better than 1.0e-05: 5
Number of HSP's better than  0.0 without gapping: 7199
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10348
length of database: 17,774,539
effective HSP length: 106
effective length of database: 13,596,973
effective search space used: 5343610389
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= OVRM1_0158_D08
         (1501 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,444,200
Number of Sequences: 1040
Number of extensions: 40661
Number of successful extensions: 158
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 132
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 158
length of database: 434,620
effective HSP length: 81
effective length of database: 350,380
effective search space used: 146458840
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= OVRM1_0158_D08
         (1501 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_038525.1| cAMP responsive element binding protein 3 [Mus ...   276   5e-74
Alignment   gi|NP_084356.1| androgen-induced basic leucine zipper [Mus musc...    94   5e-19
Alignment   gi|NP_663340.1| cAMP responsive element binding protein 3-like ...    85   2e-16
Alignment   gi|NP_848776.1| cAMP responsive element binding protein 3-like ...    71   3e-12
Alignment   gi|XP_919654.2| PREDICTED: similar to cAMP responsive element b...    70   6e-12
Alignment   gi|NP_036087.1| cAMP responsive element binding protein 3-like ...    69   2e-11

>ref|NP_038525.1| cAMP responsive element binding protein 3 [Mus musculus]
          Length = 379

 Score =  276 bits (705), Expect = 5e-74
 Identities = 174/353 (49%), Positives = 199/353 (56%), Gaps = 12/353 (3%)
 Frame = +1

Query: 190  AARDEALEAPLDWELPLSE----ALSDWDVEDFLSCLSSPPASLTDFSHSDPYLVHHDHT 357
            AA +  ++APLD EL  SE     LSDW+VED LS L SP AS  D   S    + HDH 
Sbjct: 31   AATEPDVKAPLDLELSPSENSVQELSDWEVEDLLSSLLSPSAS-RDVLGSSSSSILHDHN 89

Query: 358  YSLSQEYVSIDLDNEDYEKEGARMTSLR-VEAPAEQEIGXXXXXXXXXXXXXXXXXXXXX 534
            YSL QE+VSIDLD E +EKEG  +T L   E  AEQE+                      
Sbjct: 90   YSLPQEHVSIDLDTESFEKEGFHVTPLPGEERAAEQEMSRLILTEEEKKLLEKEGLTLPS 149

Query: 535  XXXXXRMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLL 714
                 ++EEQVL+RVRRKIRNK++AQESR+KKKVYV  LESRVLKY+AQN ELQNKVQ L
Sbjct: 150  TLPLTKVEEQVLKRVRRKIRNKRAAQESRKKKKVYVVGLESRVLKYTAQNRELQNKVQRL 209

Query: 715  EEQNXXXXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAMYSSDTRGSPPAEH 894
            EEQN            MVI+ ANK SS STC+            PAMYSSD RGS PAE+
Sbjct: 210  EEQNLSLLDQLRKLQAMVIEIANKTSSGSTCVLVLVFSFCLLLVPAMYSSDARGSVPAEY 269

Query: 895  GVLSRQLRALPSEDVPQRDLPALQSEVPQ-------DSSTHELQAPGNSCCLFHHMAWAP 1053
             VL R+LRALPSED  Q    AL SE+P        DSS H      N  C+ +H   AP
Sbjct: 270  VVLHRKLRALPSEDDHQPKPSALSSELPMDSTHQSLDSSEHMFLVSSNFSCVLYH---AP 326

Query: 1054 GAESPMKLPLPDRFSRSSSPGPIFPLHANLTREGGWPPTHSPISVTLQGRYSG 1212
             AE P+  PL D  S          L ANL+   GW P HSP  V  QGRYSG
Sbjct: 327  QAEQPLHWPLWDLSSEMLFSDSNLLLQANLSESEGWQPNHSPSLVIFQGRYSG 379


>ref|NP_084356.1| androgen-induced basic leucine zipper [Mus musculus]
          Length = 370

 Score = 93.6 bits (231), Expect = 5e-19
 Identities = 59/157 (37%), Positives = 89/157 (56%), Gaps = 8/157 (5%)
 Frame = +1

Query: 550 RMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 729
           + EE++L+++RRKIRNK+SAQ+SRR+KK Y+  LESRV   S QN +LQ KVQ LE QN 
Sbjct: 188 KAEERILKKIRRKIRNKQSAQDSRRRKKEYLDGLESRVAACSEQNQKLQRKVQELERQNI 247

Query: 730 XXXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAMY----SSDTRGSPPAEHG 897
                      +  QT+++A+ +STC+            P+       S+ R      HG
Sbjct: 248 FLMEQVRQLQKLTAQTSSRAAQTSTCVLILLFSLALIILPSFSPFQGQSEARPEDYQLHG 307

Query: 898 VLSRQLRALPSEDVPQR-DLPALQS---EVPQDSSTH 996
           V+SR +  L  E+V +  + P L+S   E+P+  +T+
Sbjct: 308 VISRNI--LTHENVTENLESPVLKSKLEELPEAPTTN 342


>ref|NP_663340.1| cAMP responsive element binding protein 3-like 3 [Mus musculus]
          Length = 479

 Score = 85.1 bits (209), Expect = 2e-16
 Identities = 46/113 (40%), Positives = 69/113 (61%), Gaps = 2/113 (1%)
 Frame = +1

Query: 550 RMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 729
           + EE+VL+++RRKIRNK+SAQESR+KKK Y+  LE+R+   +AQN ELQ KV  LE+QN 
Sbjct: 234 KYEERVLKKIRRKIRNKQSAQESRKKKKEYIDGLENRMSACTAQNQELQRKVLHLEKQNL 293

Query: 730 XXXXXXXXXXXMVIQTANKASSSSTCIXXXXXXXXXXXXPAM--YSSDTRGSP 882
                      +V+Q+ +K + + TCI            P++  ++S+   SP
Sbjct: 294 SLLEQLKHLQALVVQSTSKPAHAGTCIAVLLLSFALIILPSISPFNSNKVDSP 346


>ref|NP_848776.1| cAMP responsive element binding protein 3-like 2 [Mus musculus]
          Length = 521

 Score = 70.9 bits (172), Expect = 3e-12
 Identities = 34/59 (57%), Positives = 47/59 (79%)
 Frame = +1

Query: 550 RMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQN 726
           + EE+ L+++RRKI+NK SAQESRRKKK Y+ SLE +V   S +NLEL+ KV++LE+ N
Sbjct: 289 KSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLEDTN 347


>ref|XP_919654.2| PREDICTED: similar to cAMP responsive element binding protein
           3-like 2 [Mus musculus]
          Length = 477

 Score = 70.1 bits (170), Expect = 6e-12
 Identities = 34/59 (57%), Positives = 46/59 (77%)
 Frame = +1

Query: 550 RMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQN 726
           + EE+ L+++RRKI+NK SAQESRRKKK Y+ SLE +V   S +NLEL+ KV++LE  N
Sbjct: 245 KSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTN 303


>ref|NP_036087.1| cAMP responsive element binding protein 3-like 1 [Mus musculus]
          Length = 507

 Score = 68.6 bits (166), Expect = 2e-11
 Identities = 39/92 (42%), Positives = 54/92 (58%), Gaps = 5/92 (5%)
 Frame = +1

Query: 550 RMEEQVLRRVRRKIRNKKSAQESRRKKKVYVGSLESRVLKYSAQNLELQNKVQLLEEQNX 729
           + EE+ L+RVRRKI+NK SAQESRRKKK YV  LE +V  Y+++N EL  KV+ LE  N 
Sbjct: 285 KAEEKALKRVRRKIKNKISAQESRRKKKEYVECLEKKVETYTSENNELWKKVETLETANR 344

Query: 730 XXXXXXXXXXXMVIQTANK-----ASSSSTCI 810
                      +V    ++     A+ + TC+
Sbjct: 345 TLLQQLQKLQTLVTSKISRPYKMAATQTGTCL 376


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 73,569,269
Number of Sequences: 45328
Number of extensions: 2147814
Number of successful extensions: 11407
Number of sequences better than 1.0e-05: 6
Number of HSP's better than  0.0 without gapping: 7733
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11270
length of database: 21,768,885
effective HSP length: 108
effective length of database: 16,873,461
effective search space used: 6597523251
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)