Animal-Genome cDNA OVRM1_0170_G05


Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= OVRM1_0170_G05
         (1342 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (...   349   3e-96
Alignment   gi|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 ...   169   4e-42
Alignment   gi|NP_899207.1| double substrate-specificity short chain dehydr...   151   1e-36
Alignment   gi|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 ...   118   1e-26
Alignment   gi|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 ...   118   1e-26
Alignment   gi|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   115   6e-26
Alignment   gi|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 ...   115   8e-26
Alignment   gi|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13,...   104   2e-22
Alignment   gi|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 ...    78   2e-14
Alignment   gi|XP_583859.2| PREDICTED: similar to short chain dehydrogenase...    77   2e-14

>ref|XP_591168.2| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
            [Bos taurus]
          Length = 251

 Score =  349 bits (895), Expect = 3e-96
 Identities = 170/240 (70%), Positives = 190/240 (79%)
 Frame = +1

Query: 325  VEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXX 504
            +EFLYCDLASM+SIR+FVQ FKMKK+PLHVLVNNAGVMMVPQR TEDGFEEHFGVNY   
Sbjct: 5    MEFLYCDLASMRSIREFVQTFKMKKLPLHVLVNNAGVMMVPQRTTEDGFEEHFGVNYLGH 64

Query: 505  XXXXXXXXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSGGYSPHGAYTRSKLAL 684
                       Q                  HYVGEL+LDDLQSS  YS H AY +SKLAL
Sbjct: 65   FLLTNLLLDTLQESGAPGHSARVVTVSSATHYVGELNLDDLQSSTYYSAHAAYAQSKLAL 124

Query: 685  VLFSHRLQALLEAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGAW 864
            VLF++ LQALL A+G PVTA+VADPGVV+TDLYR+VFWGTRL+KKL GWW FKTPDEGAW
Sbjct: 125  VLFTYHLQALLTAQGMPVTASVADPGVVDTDLYRYVFWGTRLVKKLLGWWVFKTPDEGAW 184

Query: 865  TSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGIADMTRDTLWG 1044
            TSVYAAV+PALEG+GGRYLYNEKE +SL  TYDP+LQRQLWARSCQ+TGIAD+T +T  G
Sbjct: 185  TSVYAAVTPALEGLGGRYLYNEKETRSLEATYDPELQRQLWARSCQLTGIADVTWETFSG 244


>ref|XP_582319.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            [Bos taurus]
          Length = 420

 Score =  169 bits (429), Expect = 4e-42
 Identities = 109/298 (36%), Positives = 149/298 (50%), Gaps = 15/298 (5%)
 Frame = +1

Query: 166  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLN--------- 318
            G+  ++TG   G+G ATA  L RLG  VI+   +  +A EA  ++R E            
Sbjct: 127  GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRERAEEAAGQLRREVCPAGGPDSGPN 186

Query: 319  ----DKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFG 486
                 ++     DLAS+ S+R F Q+   ++  L VL+NNAGV   P  +TEDGFE  FG
Sbjct: 187  SGGAGELVVKELDLASLSSVRSFCQEMLQEEPRLDVLINNAGVFQCPYMKTEDGFEMQFG 246

Query: 487  VNYXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSGGYSPHGAYT 666
            VN+              +                  +  G+++ +DL S   Y+    Y+
Sbjct: 247  VNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKL----YKYGDINFEDLNSEQSYNKSFCYS 302

Query: 667  RSKLALVLFSHRLQALLEAKGSPVTANVADPGVVNTDLYRHVFWG--TRLLKKLFGWWFF 840
            RSKLA +LF+  L   LE  G+ VT NV  PG+V T+L RH+      R L  L  W FF
Sbjct: 303  RSKLANILFTRELARRLE--GTSVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVSWAFF 360

Query: 841  KTPDEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1014
            KTP+EGA T+VY A SP +EGV GRY  + KE + L    D  + R+LW  S  M GI
Sbjct: 361  KTPEEGAQTAVYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 418


>ref|NP_899207.1| double substrate-specificity short chain dehydrogenase/reductase 2
            [Bos taurus]
          Length = 316

 Score =  151 bits (382), Expect = 1e-36
 Identities = 101/283 (35%), Positives = 142/283 (50%)
 Frame = +1

Query: 166  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 345
            G+V ++TG   GIG  TA+ LAR G  V IA  +  K   A  +I+ +T N +V     D
Sbjct: 39   GKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIQADTKNSQVLVRKLD 98

Query: 346  LASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXX 525
            L+  KSIR F + F  ++  LH+L+NNAGVM+ P  +T DGFE H  VN+          
Sbjct: 99   LSDTKSIRAFAEGFLAEEKQLHILINNAGVMLCPYSKTADGFETHLAVNHLGHFLLTHLL 158

Query: 526  XXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSGGYSPHGAYTRSKLALVLFSHRL 705
                +                  H++G++   DLQ    Y+   AY  SKLA VLF+  L
Sbjct: 159  LGRLK----ESAPARVVNLSSVAHHLGKIRFHDLQGDKYYNLGFAYCHSKLANVLFTREL 214

Query: 706  QALLEAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGAWTSVYAAV 885
               L  KG+ VT     PG+V + L RH F    LL +LF   F KT  EGA TS++ A+
Sbjct: 215  AKRL--KGTGVTTYAVHPGIVRSKLVRHSFL-LCLLWRLFS-PFLKTTWEGAQTSLHCAL 270

Query: 886  SPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1014
            +  LE + G+Y  + K+        + K   +LW  SC++ GI
Sbjct: 271  AEGLEPLSGKYFSDCKKTWVSPRARNNKTAERLWNVSCELLGI 313


>ref|XP_592820.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
            taurus]
          Length = 377

 Score =  118 bits (295), Expect = 1e-26
 Identities = 89/286 (31%), Positives = 128/286 (44%), Gaps = 3/286 (1%)
 Frame = +1

Query: 166  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 345
            GR A+VTG   GIG  TA  LAR G  V++A  +  +   A   +R+E+ N++V F+  D
Sbjct: 36   GRTAVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALD 95

Query: 346  LASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXX 525
            LAS+ S+R F   F   +  L +L++NAG+    +  T + F     VN+          
Sbjct: 96   LASLASVRAFATAFLSSEPRLDILIHNAGISSCGR--TREPFNLLLRVNHIGPFLLTHLL 153

Query: 526  XXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSS--GGYSPHGAYTRSKLALVLFSH 699
                +                  H  G LD   L     G      AY  SKLA VLF+ 
Sbjct: 154  LPRLK----TSAPSRVVVVSSAAHRRGRLDFTRLDHPVVGWQQELRAYANSKLANVLFAR 209

Query: 700  RLQALLEAKGSPVTANVADPGVVNTDLY-RHVFWGTRLLKKLFGWWFFKTPDEGAWTSVY 876
             L   LE  G+ VT   A PG VN++L+ RHV    R L +   W   + P  GA T +Y
Sbjct: 210  ELATQLE--GTGVTCYAAHPGPVNSELFLRHVPGWLRPLLRPLAWLVLRAPRGGAQTPLY 267

Query: 877  AAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1014
             A+   +E + GRY  N    +      D +   +LW  S ++ G+
Sbjct: 268  CALQEGIEPLSGRYFANCHVEEVPPAARDDRAAHRLWEASRKLAGL 313


>ref|XP_584642.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Bos
            taurus]
          Length = 330

 Score =  118 bits (295), Expect = 1e-26
 Identities = 87/293 (29%), Positives = 137/293 (46%), Gaps = 7/293 (2%)
 Frame = +1

Query: 166  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 345
            G+ A+VTG   GIG A ++ LA  G  VI+A  +  + ++A+ +I+  + ++++     D
Sbjct: 49   GKTAVVTGANSGIGKAVSQELAHRGARVILACRSRERGQQALAEIQATSKSNRLLLGEVD 108

Query: 346  LASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXX 525
            L+SM SIR F Q+   +   +H+LVNNA V   P   T +G +  F  NY          
Sbjct: 109  LSSMASIRSFAQRLLQECPEIHLLVNNAAVCGFPTTLTPEGLDLTFATNYTGPFLLTNLL 168

Query: 526  XXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSG-GYSPHGAYTRSKLALVLFSHR 702
                Q                     G +D D L  +G   + +  Y  SKL L  F+ +
Sbjct: 169  QGALQRAGSARVVNVSSFRQSH----GYIDEDHLIGAGRPLTFNQNYDCSKLLLASFTGK 224

Query: 703  LQALLEAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGAWTSVYAA 882
            L   L+  G+ VT N  DPGVV T + +H  W  R L  L   +FFK   +GA   +Y +
Sbjct: 225  LAQRLQ--GTGVTVNSVDPGVVYTKIMKHFSWSYRFLFWLLS-FFFKDSKQGAVPVLYLS 281

Query: 883  VSPALEGVGGRYLYNEKEAKSLAIT------YDPKLQRQLWARSCQMTGIADM 1023
            ++  L+G+ G++      + S  IT       DP + + LW  S ++T +  M
Sbjct: 282  LAKELDGISGKHF-----SSSCVITLPPEAAQDPHVAQSLWNTSVRLTNLDKM 329


>ref|XP_870721.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) isoform 2 [Bos
            taurus]
          Length = 314

 Score =  115 bits (289), Expect = 6e-26
 Identities = 88/288 (30%), Positives = 129/288 (44%), Gaps = 4/288 (1%)
 Frame = +1

Query: 163  PGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYC 342
            PG+VA+VTG   GIG  TAK LAR G  V +A  +        R+I+  T N +V     
Sbjct: 14   PGKVAVVTGANAGIGKETAKELARRGARVYLACRDVQNGELVAREIQMMTGNQQVLVRKL 73

Query: 343  DLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXX 522
            DLA  KSIR F ++F      +H++ ++   ++     +  G +      Y         
Sbjct: 74   DLADTKSIRAFAKRFLEDHKYIHLINSSPHFLICGFPGSSAGKDSACNTGYLGHFLLTHL 133

Query: 523  XXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSGGYSPHGAYTRSKLALVLFSHR 702
                 +                  H +G +   +LQ    Y    AY  SKLA +LF+  
Sbjct: 134  LLEKLEESAPSRVVNVSSLA----HLLGRIHFHNLQGEKFYQSGLAYCHSKLANILFTQE 189

Query: 703  LQALLEAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFF----KTPDEGAWTS 870
            L   L  KGS VT     PG VN++L RH    + L++ +  WW F    KTP +GA TS
Sbjct: 190  LARRL--KGSGVTVYSVHPGTVNSELVRH----SALMRWI--WWIFSFFIKTPQQGAQTS 241

Query: 871  VYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1014
            +Y A++  LE + G +  +   A   A   +  + R+LW  SC + GI
Sbjct: 242  LYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSCDLLGI 289


>ref|XP_582373.2| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) isoform 1 [Bos
            taurus]
          Length = 308

 Score =  115 bits (288), Expect = 8e-26
 Identities = 91/290 (31%), Positives = 128/290 (44%), Gaps = 6/290 (2%)
 Frame = +1

Query: 163  PGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYC 342
            PG+VA+VTG   GIG  TAK LAR G  V +A  +        R+I+  T N +V     
Sbjct: 14   PGKVAVVTGANAGIGKETAKELARRGARVYLACRDVQNGELVAREIQMMTGNQQVLVRKL 73

Query: 343  DLASMKSIRQFVQKFKMKKIPLHVL--VNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXX 516
            DLA  KSIR F ++F      +H++  V   G           G+  HF + +       
Sbjct: 74   DLADTKSIRAFAKRFLEDHKYIHLINSVGFPGSSAGKDSACNTGYLGHFLLTHLLLEKLE 133

Query: 517  XXXXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSGGYSPHGAYTRSKLALVLFS 696
                                      H +G +   +LQ    Y    AY  SKLA +LF+
Sbjct: 134  ESAPSRV------------VNVSSLAHLLGRIHFHNLQGEKFYQSGLAYCHSKLANILFT 181

Query: 697  HRLQALLEAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFF----KTPDEGAW 864
              L   L  KGS VT     PG VN++L RH    + L++ +  WW F    KTP +GA 
Sbjct: 182  QELARRL--KGSGVTVYSVHPGTVNSELVRH----SALMRWI--WWIFSFFIKTPQQGAQ 233

Query: 865  TSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1014
            TS+Y A++  LE + G +  +   A   A   +  + R+LW  SC + GI
Sbjct: 234  TSLYCALTEGLEVLSGNHFSDCHVAWVSAQARNETVARRLWDVSCDLLGI 283


>ref|XP_584629.2| PREDICTED: similar to Retinol dehydrogenase 13, partial [Bos
           taurus]
          Length = 148

 Score =  104 bits (259), Expect = 2e-22
 Identities = 59/130 (45%), Positives = 77/130 (59%)
 Frame = +1

Query: 106 AQLLRRCRGGFAEPVFPPQPGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKARE 285
           A LL+    G A P     PG+  IVTG   GIG  TA  LA+ G ++I+A  +  K   
Sbjct: 18  AVLLKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNIILACRDMEKCEA 77

Query: 286 AVRKIREETLNDKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETED 465
           A ++IR ETLN +V   + DLAS+KSIR+F  K   ++  +H+L+NNA VM  P   TED
Sbjct: 78  AAKEIRGETLNHRVNARHLDLASLKSIREFAAKVTEEEEHVHILINNAAVMRCPHWTTED 137

Query: 466 GFEEHFGVNY 495
           GFE   GVNY
Sbjct: 138 GFEMQLGVNY 147


>ref|XP_584810.2| PREDICTED: similar to retinol dehydrogenase 13 (all-trans and 9-cis)
            [Bos taurus]
          Length = 223

 Score = 77.8 bits (190), Expect = 2e-14
 Identities = 51/146 (34%), Positives = 73/146 (50%), Gaps = 6/146 (4%)
 Frame = +1

Query: 595  HYVGELDLDDLQ-SSGGYSPHGAYTRSKLALVLFSHRLQALLEAKGSPVTANVADPGVVN 771
            H  G +D +DL      Y    AY +SKLA+V+ +  L   L+  G  VT N   PGV  
Sbjct: 65   HVAGHIDFEDLNWEKRKYDTKAAYCQSKLAVVVSTKELSRRLQGTG--VTVNALHPGVAR 122

Query: 772  TDLYRHV-----FWGTRLLKKLFGWWFFKTPDEGAWTSVYAAVSPALEGVGGRYLYNEKE 936
            T+L RH       + +  L  +F W   K+P+  A  SVY AV+  LEGV G+Y    KE
Sbjct: 123  TELGRHTGMHSSAFSSFTLGPIF-WLLVKSPELAAQPSVYLAVAEELEGVSGKYFDVLKE 181

Query: 937  AKSLAITYDPKLQRQLWARSCQMTGI 1014
                    D ++ ++LWA S ++ G+
Sbjct: 182  KPPAPEAEDEEVAKRLWAESVRLVGL 207


>ref|XP_583859.2| PREDICTED: similar to short chain dehydrogenase/reductase [Bos
           taurus]
          Length = 317

 Score = 77.4 bits (189), Expect = 2e-14
 Identities = 45/110 (40%), Positives = 65/110 (59%)
 Frame = +1

Query: 163 PGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYC 342
           PGR  +VTGG  GIG ATA  +A+ G  V +   + S+A  A  +I  E+ N  +     
Sbjct: 39  PGRAFMVTGGNSGIGKATAMEIAKRGGTVHLVCRDHSRAEGAKAEIIRESGNQNIFLHIV 98

Query: 343 DLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVN 492
           DL+  KS+ +FV+ FK +   L+VL+NNAG M+  +  TEDG E++F  N
Sbjct: 99  DLSLPKSVWKFVENFKQEH-TLNVLINNAGCMVNKRELTEDGLEKNFATN 147


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 40,365,419
Number of Sequences: 33508
Number of extensions: 1082127
Number of successful extensions: 6752
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 4860
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6658
length of database: 16,112,626
effective HSP length: 105
effective length of database: 12,594,286
effective search space used: 4294651526
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= OVRM1_0170_G05
         (1342 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (...   447   e-125
Alignment   gi|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 ...   169   4e-42
Alignment   gi|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 ...   166   5e-41
Alignment   gi|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 ...   163   4e-40
Alignment   gi|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 ...   159   6e-39
Alignment   gi|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 ...   123   5e-28
Alignment   gi|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 ...   115   7e-26
Alignment   gi|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 ...   111   2e-24
Alignment   gi|XP_852623.1| PREDICTED: similar to WW domain-containing oxid...   108   9e-24
Alignment   gi|XP_544873.2| PREDICTED: similar to carbonyl reductase 3 [Can...    62   2e-09

>ref|XP_852222.1| PREDICTED: similar to dehydrogenase/reductase (SDR family) X-linked
            [Canis familiaris]
          Length = 387

 Score =  447 bits (1150), Expect = e-125
 Identities = 218/309 (70%), Positives = 244/309 (78%)
 Frame = +1

Query: 118  RRCRGGFAEPVFPPQPGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRK 297
            R  R     P   PQP RVAIVTGGT+GIG++TAKHLARLGMHVI+AGNNDS A + VRK
Sbjct: 79   RFSRVHMGNPFLAPQPERVAIVTGGTDGIGYSTAKHLARLGMHVILAGNNDSSAPDVVRK 138

Query: 298  IREETLNDKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEE 477
            I+EETLNDKVEFLYCDLAS++SIRQFVQKFK KKIPLHVLVNNAGVMMVP+R TEDGFEE
Sbjct: 139  IQEETLNDKVEFLYCDLASLRSIRQFVQKFKKKKIPLHVLVNNAGVMMVPERTTEDGFEE 198

Query: 478  HFGVNYXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSGGYSPHG 657
            HFG+NY              +                  HY+GELD+DDLQ S  YSPH 
Sbjct: 199  HFGLNYLGHFLLTNLLLDTLKESGAPGRCARVVTVSSATHYIGELDMDDLQGSRCYSPHA 258

Query: 658  AYTRSKLALVLFSHRLQALLEAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWF 837
            AY +SKLALVLF++ LQ LL A+GSPVTANV DPGVVNT+LYRHVFWGTRL+KKLFGWWF
Sbjct: 259  AYAQSKLALVLFTYHLQRLLAAQGSPVTANVVDPGVVNTNLYRHVFWGTRLIKKLFGWWF 318

Query: 838  FKTPDEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGIA 1017
            FKTPDEGAWTSVYAAV+P LEG+GGRYLYNEKE KSLA+TYD  LQ +LWARSCQMTGI 
Sbjct: 319  FKTPDEGAWTSVYAAVTPDLEGLGGRYLYNEKETKSLAVTYDLDLQTELWARSCQMTGIT 378

Query: 1018 DMTRDTLWG 1044
            D+++DT  G
Sbjct: 379  DVSQDTFSG 387


>ref|XP_854127.1| PREDICTED: similar to Retinol dehydrogenase 13 [Canis familiaris]
          Length = 334

 Score =  169 bits (429), Expect = 4e-42
 Identities = 113/309 (36%), Positives = 152/309 (49%), Gaps = 6/309 (1%)
 Frame = +1

Query: 106  AQLLRRCRGGFAEPVFPPQPGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKARE 285
            A LLR    G A P     PG+  IVTG   GIG  TA  LAR G ++I+A  +  K   
Sbjct: 18   AVLLRDYIAGGACPSKATIPGKTVIVTGANTGIGKQTALELARRGGNIILACRDMEKCEA 77

Query: 286  AVRKIREETLNDKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETED 465
            A ++IR ETLN +V   + DLAS+KSIR+F  K   ++  +H+LVNNA VM  P   T+D
Sbjct: 78   AAKEIRGETLNHRVSAWHLDLASLKSIREFAAKIIEEEEQVHILVNNAAVMRCPHWTTKD 137

Query: 466  GFEEHFGVNYXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQ-SSGG 642
            GFE  FGVN+              +                  H  G +D DDL      
Sbjct: 138  GFEMQFGVNHLGHFLLTNLLLDKLK----ASAPSRIINLSSLAHVAGHIDFDDLNWEKRK 193

Query: 643  YSPHGAYTRSKLALVLFSHRLQALLEAKGSPVTANVADPGVVNTDLYRHV-----FWGTR 807
            Y    AY +SKLA++LF+  L   L+  G+ VT N   PGV  T+L RH       + + 
Sbjct: 194  YDTKAAYCQSKLAVILFTKELSRRLQ--GTGVTVNALHPGVARTELGRHTGMHSSAFSSF 251

Query: 808  LLKKLFGWWFFKTPDEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLW 987
             L  +F W   K+P   A  S Y AV+  LEGV G+Y    KE        D ++ ++LW
Sbjct: 252  TLGPIF-WLLVKSPQLAAQPSTYLAVAEELEGVSGKYFDGLKEKAPAPEAEDEEVAQRLW 310

Query: 988  ARSCQMTGI 1014
            A S ++ G+
Sbjct: 311  AESARLVGL 319


>ref|XP_540096.2| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            isoform 1 [Canis familiaris]
          Length = 336

 Score =  166 bits (420), Expect = 5e-41
 Identities = 108/298 (36%), Positives = 150/298 (50%), Gaps = 15/298 (5%)
 Frame = +1

Query: 166  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLN--------- 318
            G+  ++TG   G+G ATA  L RLG  VI+   + ++A EA  ++R E            
Sbjct: 43   GKTVLITGANSGLGRATAAALLRLGARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSD 102

Query: 319  ----DKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFG 486
                 ++     DLAS++S+R F Q+   ++  L VL+NNAG+   P  +TEDGFE  FG
Sbjct: 103  VGAAGELVVRELDLASLRSVRAFCQEVLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFG 162

Query: 487  VNYXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSGGYSPHGAYT 666
            VN+              +                  +  G+++ +DL S   Y+    Y+
Sbjct: 163  VNHLGHFLLTNLLLGLLKNSAPSRIVVVSSKL----YKYGDINFEDLNSEQSYNKSFCYS 218

Query: 667  RSKLALVLFSHRLQALLEAKGSPVTANVADPGVVNTDLYRHVFWG--TRLLKKLFGWWFF 840
            RSKLA +LF+  L   LE  G+ VT NV  PG+V T+L RH+      R L  L  W FF
Sbjct: 219  RSKLANILFTRELARRLE--GTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVSWAFF 276

Query: 841  KTPDEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1014
            KTP EGA TSVY A SP +EGV G+Y  + KE + L    D  + R+LW  S  M GI
Sbjct: 277  KTPVEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 334


>ref|XP_547866.2| PREDICTED: similar to retinol dehydrogenase 12 (all-trans and 9-cis)
            [Canis familiaris]
          Length = 303

 Score =  163 bits (412), Expect = 4e-40
 Identities = 105/284 (36%), Positives = 146/284 (51%)
 Frame = +1

Query: 163  PGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYC 342
            PG+V ++TG   GIG  TA+ LAR G  V IA  +  K   A  +IR +T N +V     
Sbjct: 25   PGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKL 84

Query: 343  DLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXX 522
            DL+  KSIR F + F  ++  LH+L+NNAGVMM P  +T DGFE H GVN+         
Sbjct: 85   DLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMCPYSKTADGFETHLGVNHLGHFLLTHL 144

Query: 523  XXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSGGYSPHGAYTRSKLALVLFSHR 702
                 +                  H++G++   DLQ    YS   AY  SKLA +LF+  
Sbjct: 145  LLERLK----ESTPARVVNLSSVAHHIGKIHFHDLQGEKRYSRGFAYCHSKLANMLFTRE 200

Query: 703  LQALLEAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGAWTSVYAA 882
            L   L+  G+ VT     PGVV+++L RH F    LL ++F   F K+  EGA TS++ A
Sbjct: 201  LAKRLQ--GTGVTTYAVHPGVVSSELVRHSFL-LCLLWRIFS-PFVKSAREGAQTSLHCA 256

Query: 883  VSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1014
            ++  LE + G+Y  + K A       D K   +LW  SC++ GI
Sbjct: 257  LAEGLEPLSGKYFSDCKRAWVSPRARDNKTAERLWNVSCELLGI 300


>ref|XP_854354.1| PREDICTED: similar to Retinol dehydrogenase 11 (Retinal reductase 1)
            (RalR1) (Prostate short-chain dehydrogenase/reductase 1)
            (Androgen-regulated short-chain dehydrogenase/reductase
            1) (HCV core-binding protein HCBP12) [Canis familiaris]
          Length = 337

 Score =  159 bits (402), Expect = 6e-39
 Identities = 105/288 (36%), Positives = 144/288 (50%), Gaps = 4/288 (1%)
 Frame = +1

Query: 163  PGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYC 342
            PG+VA+VTG   GIG  TAK LA+ G  V +A  +  K     R+I+  T N +V     
Sbjct: 59   PGKVAVVTGANTGIGKETAKELAQRGARVYLACRDVLKGELVAREIQTMTGNKQVLVRKL 118

Query: 343  DLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXX 522
            DLA  KSIR F + F  ++  LH+L+NNAGVMM P  +T DGFE H GVN+         
Sbjct: 119  DLADTKSIRAFAKGFLAEEKHLHILINNAGVMMCPYTKTVDGFEMHMGVNHLGHFLLTHL 178

Query: 523  XXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSGGYSPHGAYTRSKLALVLFSHR 702
                 +                  H++G +   DLQ    Y+   AY  SKLA +LF+  
Sbjct: 179  LLEKLK----ESAPSRIVNVSSLAHHLGRIHFHDLQGEKFYNSGLAYCHSKLANILFTQE 234

Query: 703  LQALLEAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWW----FFKTPDEGAWTS 870
            L   L  KGS +TA    PG V ++L RH    +  +K +  WW    F KTP +GA TS
Sbjct: 235  LARRL--KGSGITAYSVHPGTVKSELVRH----SPFMKWM--WWLFSFFIKTPQQGAQTS 286

Query: 871  VYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1014
            +Y A++  LE + G +  +   A   A   +  + R+LW  SC + GI
Sbjct: 287  LYCAITEGLEVLSGHHFSDCSVAWVSAQARNETIARRLWDVSCDLLGI 334


>ref|XP_857582.1| PREDICTED: similar to retinol dehydrogenase 14 (all-trans and 9-cis)
            isoform 4 [Canis familiaris]
          Length = 307

 Score =  123 bits (308), Expect = 5e-28
 Identities = 94/298 (31%), Positives = 131/298 (43%), Gaps = 15/298 (5%)
 Frame = +1

Query: 166  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLN--------- 318
            G+  ++TG   G+G ATA  L RLG  VI+   + ++A EA  ++R E            
Sbjct: 43   GKTVLITGANSGLGRATAAALLRLGARVIMGCRDRARAEEAAGQLRRELRQAGGREPGSD 102

Query: 319  ----DKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFG 486
                 ++     DLAS++S+R F Q+                                FG
Sbjct: 103  VGAAGELVVRELDLASLRSVRAFCQEVLQ-----------------------------FG 133

Query: 487  VNYXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSGGYSPHGAYT 666
            VN+              +                  +  G+++ +DL S   Y+    Y+
Sbjct: 134  VNHLGHFLLTNLLLGLLKNSAPSRIVVVSSKL----YKYGDINFEDLNSEQSYNKSFCYS 189

Query: 667  RSKLALVLFSHRLQALLEAKGSPVTANVADPGVVNTDLYRHVFWG--TRLLKKLFGWWFF 840
            RSKLA +LF+  L   LE  G+ VT NV  PG+V T+L RH+      R L  L  W FF
Sbjct: 190  RSKLANILFTRELARRLE--GTNVTVNVLHPGIVRTNLGRHIHIPLLVRPLFNLVSWAFF 247

Query: 841  KTPDEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1014
            KTP EGA TSVY A SP +EGV G+Y  + KE + L    D  + R+LW  S  M GI
Sbjct: 248  KTPVEGAQTSVYLASSPEVEGVSGKYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 305


>ref|XP_548293.2| PREDICTED: similar to retinol dehydrogenase 11 (predicted) [Canis
            familiaris]
          Length = 377

 Score =  115 bits (289), Expect = 7e-26
 Identities = 92/287 (32%), Positives = 129/287 (44%), Gaps = 4/287 (1%)
 Frame = +1

Query: 166  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 345
            GR A+VTG   GIG  TA  LAR G  V++A  +  +   A   +R+E+ N++V F+  D
Sbjct: 36   GRTAVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALD 95

Query: 346  LASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXX 525
            LAS+ S+R F   F   +  L +L++NAG+    +  T   F     VN+          
Sbjct: 96   LASLASVRAFATAFLSSEPRLDILIHNAGISSCGR--THKPFNLLLRVNHIGPFLLTHLL 153

Query: 526  XXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSS--GGYSPHGAYTRSKLALVLFSH 699
                +                  H  G LD   L     G      AY  SKLA VLF+ 
Sbjct: 154  LPRLK----TCAPSRVVVVSSAAHRRGRLDFTRLDRPVVGWQQELRAYADSKLANVLFAR 209

Query: 700  RLQALLEAKGSPVTANVADPGVVNTDLY-RHV-FWGTRLLKKLFGWWFFKTPDEGAWTSV 873
             L   LE  G+ VT   A PG VN++L+ RHV  W   LL+ L  W   + P  GA T +
Sbjct: 210  ELATQLE--GTGVTCYAAHPGPVNSELFLRHVPGWLCPLLRPL-AWLMLRAPRGGAQTPL 266

Query: 874  YAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1014
            Y A+   +E + GRY  N    +      D +   QLW  S ++ G+
Sbjct: 267  YCALQEGIEPLSGRYFANCHVEEVPPAARDDRAAHQLWEASKRLAGL 313


>ref|XP_533000.2| PREDICTED: similar to Retinol dehydrogenase 12 [Canis familiaris]
          Length = 596

 Score =  111 bits (277), Expect = 2e-24
 Identities = 89/293 (30%), Positives = 134/293 (45%), Gaps = 7/293 (2%)
 Frame = +1

Query: 166  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 345
            G+ A+VTG   GIG A  + LAR G  VI+A  N  + ++A+ +I+  +    +     D
Sbjct: 315  GKTAVVTGANSGIGKAVCQELARRGARVILACRNWERGQKALAEIQVASKGTCLLLGQVD 374

Query: 346  LASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXX 525
            L+SM SIR F +    +   +H+LVNNA +   P+  T +G +  F  NY          
Sbjct: 375  LSSMASIRSFARWLLQEYPEIHLLVNNAAISGFPKTLTPEGLDLTFATNY----VGPFLL 430

Query: 526  XXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSG-GYSPHGAYTRSKLALVLFSHR 702
                Q                  H  G +D   L  +G   +   +Y  SKL L  F+  
Sbjct: 431  TNLLQGALQRAGSARVVNVSSFRHAHGYVDEKHLTGAGKPLNLIQSYDCSKLLLTSFTGE 490

Query: 703  LQALLEAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGAWTSVYAA 882
            L   L+  G+ VT N  DPGVV T++ +   W  R L  LF  +F K   +GA   +Y +
Sbjct: 491  LARRLQ--GTGVTVNSVDPGVVYTEIMKPYPWLYRFLFWLFS-FFCKDVKQGAIPVLYLS 547

Query: 883  VSPALEGVGGRYLYNEKEAKSLAIT------YDPKLQRQLWARSCQMTGIADM 1023
            ++  L+GV G+Y      + S  IT       DP++ + LW  S Q+T +  M
Sbjct: 548  LAKELDGVSGKYF-----SSSCMITLPTEAAQDPQVAQSLWNASVQLTNLDKM 595


>ref|XP_852623.1| PREDICTED: similar to WW domain-containing oxidoreductase isoform 1
           [Canis familiaris]
          Length = 383

 Score =  108 bits (271), Expect = 9e-24
 Identities = 78/220 (35%), Positives = 100/220 (45%), Gaps = 4/220 (1%)
 Frame = +1

Query: 166 GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 345
           G+V +VTG   GIGF TAK  A  G HVI+A  N ++A EAV +I  E    KVE +  D
Sbjct: 124 GKVVVVTGANSGIGFETAKSFALHGAHVILACRNMTRANEAVSQILGEWHKAKVEAMTLD 183

Query: 346 LASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXX 525
           LA ++S++ F Q FK K + LHVLV NA    +P   T+DG E  F VN+          
Sbjct: 184 LALLRSVQHFAQAFKAKNVSLHVLVCNAAAFALPWSLTKDGLETTFQVNHLGHFYLVQLL 243

Query: 526 XX---XXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQ-SSGGYSPHGAYTRSKLALVLF 693
                                        G+LD   L  S   Y    AY RSKL  +LF
Sbjct: 244 QDVLCRSAPARVVVVSSESHRFTDINDSSGKLDFSRLSPSKSDYWAMLAYNRSKLCNILF 303

Query: 694 SHRLQALLEAKGSPVTANVADPGVVNTDLYRHVFWGTRLL 813
           S+ L   L  +G  VT+N   PG +        +W   LL
Sbjct: 304 SNELHRRLSPRG--VTSNAVHPGNMMYSSIHRNWWVYTLL 341


>ref|XP_544873.2| PREDICTED: similar to carbonyl reductase 3 [Canis familiaris]
          Length = 484

 Score = 61.6 bits (148), Expect = 2e-09
 Identities = 40/109 (36%), Positives = 63/109 (57%), Gaps = 7/109 (6%)
 Frame = +1

Query: 154 PPQPG-----RVAIVTGGTEGIGFATAKHLAR-LGMHVIIAGNNDSKAREAVRKIREETL 315
           PP P      RVA+VTG   GIGFA A+ L R     V++   ++++ R AV++++ E L
Sbjct: 203 PPLPAMSSCSRVALVTGANRGIGFAIARELCRQFSGDVVLTARDEARGRAAVQQLQAEGL 262

Query: 316 NDKVEFL-YCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRET 459
           + +   L   DL S++++R F++K   +   L+VLVNNAG+   P   T
Sbjct: 263 SPRFHLLDIDDLQSIRALRDFLRK---EYGGLNVLVNNAGIAFKPDDPT 308


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 47,384,935
Number of Sequences: 33732
Number of extensions: 1271554
Number of successful extensions: 8124
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 5596
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7978
length of database: 19,266,565
effective HSP length: 106
effective length of database: 15,690,973
effective search space used: 5334930820
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= OVRM1_0170_G05
         (1342 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [...   461   e-130
Alignment   gi|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) ...   168   8e-42
Alignment   gi|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) ...   158   9e-39
Alignment   gi|NP_057110.2| androgen-regulated short-chain dehydrogenase/re...   148   1e-35
Alignment   gi|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [...   139   4e-33
Alignment   gi|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   135   8e-32
Alignment   gi|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]        100   3e-21
Alignment   gi|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase...    72   1e-12
Alignment   gi|XP_947127.1| PREDICTED: similar to short-chain dehydrogenase...    72   1e-12
Alignment   gi|NP_005785.1| dehydrogenase/reductase (SDR family) member 2 i...    54   2e-07

>ref|NP_660160.1| dehydrogenase/reductase (SDR family) X-linked [Homo sapiens]
          Length = 330

 Score =  461 bits (1187), Expect = e-130
 Identities = 223/309 (72%), Positives = 251/309 (81%)
 Frame = +1

Query: 100  ILAQLLRRCRGGFAEPVFPPQPGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKA 279
            ILAQLLRRCRGGF EPVFPP+P RVAIVTGGT+GIG++TAKHLARLGMHVIIAGNNDSKA
Sbjct: 21   ILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKA 80

Query: 280  REAVRKIREETLNDKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRET 459
            ++ V KI+EETLNDKVEFLYCDLASM SIRQFVQKFKMKKIPLHVL+NNAGVMMVPQR+T
Sbjct: 81   KQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKT 140

Query: 460  EDGFEEHFGVNYXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSG 639
             DGFEEHFG+NY              +                  HYV EL++DDLQSS 
Sbjct: 141  RDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSA 200

Query: 640  GYSPHGAYTRSKLALVLFSHRLQALLEAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKK 819
             YSPH AY +SKLALVLF++ LQ LL A+GS VTANV DPGVVNTDLY+HVFW TRL KK
Sbjct: 201  CYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKK 260

Query: 820  LFGWWFFKTPDEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSC 999
            L GW  FKTPDEGAWTS+YAAV+P LEGVGGRYLYNEKE KSL +TY+ KLQ+QLW++SC
Sbjct: 261  LLGWLLFKTPDEGAWTSIYAAVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSC 320

Query: 1000 QMTGIADMT 1026
            +MTG+ D+T
Sbjct: 321  EMTGVLDVT 329


>ref|NP_065956.1| retinol dehydrogenase 14 (all-trans and 9-cis) [Homo sapiens]
          Length = 336

 Score =  168 bits (426), Expect = 8e-42
 Identities = 109/299 (36%), Positives = 152/299 (50%), Gaps = 16/299 (5%)
 Frame = +1

Query: 166  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLN--------- 318
            G+  ++TG   G+G ATA  L RLG  VI+   + ++A EA  ++R E            
Sbjct: 43   GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQAAECGPEPG 102

Query: 319  ----DKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFG 486
                 ++     DLAS++S+R F Q+   ++  L VL+NNAG+   P  +TEDGFE  FG
Sbjct: 103  VSGVGELIVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFG 162

Query: 487  VNYXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSGGYSPHGAYT 666
            VN+              +                  +  G+++ DDL S   Y+    Y+
Sbjct: 163  VNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKL----YKYGDINFDDLNSEQSYNKSFCYS 218

Query: 667  RSKLALVLFSHRLQALLEAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFG---WWF 837
            RSKLA +LF+  L   LE  G+ VT NV  PG+V T+L RH+     L+K LF    W F
Sbjct: 219  RSKLANILFTRELARRLE--GTNVTVNVLHPGIVRTNLGRHIHIPL-LVKPLFNLVSWAF 275

Query: 838  FKTPDEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1014
            FKTP EGA TS+Y A SP +EGV GRY  + KE + L    D  + R+LW  S  M G+
Sbjct: 276  FKTPVEGAQTSIYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGL 334


>ref|NP_689656.1| retinol dehydrogenase 12 (all-trans and 9-cis) [Homo sapiens]
          Length = 316

 Score =  158 bits (400), Expect = 9e-39
 Identities = 105/284 (36%), Positives = 143/284 (50%)
 Frame = +1

Query: 163  PGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYC 342
            PG+V ++TG   GIG  TA+ LA  G  V IA  +  K   A  +IR +T N +V     
Sbjct: 38   PGKVVVITGANTGIGKETARELASRGARVYIACRDVLKGESAASEIRVDTKNSQVLVRKL 97

Query: 343  DLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXX 522
            DL+  KSIR F + F  ++  LH+L+NNAGVMM P  +T DGFE H GVN+         
Sbjct: 98   DLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMCPYSKTADGFETHLGVNHLGHFLLTYL 157

Query: 523  XXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSGGYSPHGAYTRSKLALVLFSHR 702
                 +                  H++G++   DLQS   YS   AY  SKLA VLF+  
Sbjct: 158  LLEQLK----VSAPARVVNVSSVAHHIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRE 213

Query: 703  LQALLEAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGAWTSVYAA 882
            L   L+  G+ VT     PGVV ++L RH      LL +LF   F KT  EGA TS++ A
Sbjct: 214  LAKRLQ--GTGVTTYAVHPGVVRSELVRHSSL-LCLLWRLFS-PFVKTAREGAQTSLHCA 269

Query: 883  VSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1014
            ++  LE + G+Y  + K         + K   +LW  SC++ GI
Sbjct: 270  LAEGLEPLSGKYFSDCKRTWVSPRARNNKTAERLWNVSCELLGI 313


>ref|NP_057110.2| androgen-regulated short-chain dehydrogenase/reductase 1 [Homo
            sapiens]
          Length = 318

 Score =  148 bits (373), Expect = 1e-35
 Identities = 99/284 (34%), Positives = 141/284 (49%)
 Frame = +1

Query: 163  PGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYC 342
            PG+V +VTG   GIG  TAK LA+ G  V +A  +  K     ++I+  T N +V     
Sbjct: 40   PGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKL 99

Query: 343  DLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXX 522
            DL+  KSIR F + F  ++  LHVL+NNAGVMM P  +T DGFE H GVN+         
Sbjct: 100  DLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHL 159

Query: 523  XXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSGGYSPHGAYTRSKLALVLFSHR 702
                 +                  H++G +   +LQ    Y+   AY  SKLA +LF+  
Sbjct: 160  LLEKLK----ESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQE 215

Query: 703  LQALLEAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGAWTSVYAA 882
            L   L  KGS VT     PG V ++L RH  +  R +  LF  +F KTP +GA TS++ A
Sbjct: 216  LARRL--KGSGVTTYSVHPGTVQSELVRHSSF-MRWMWWLFS-FFIKTPQQGAQTSLHCA 271

Query: 883  VSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1014
            ++  LE + G +  +   A       +  + R+LW  SC + G+
Sbjct: 272  LTEGLEILSGNHFSDCHVAWVSVQARNETIARRLWDVSCDLLGL 315


>ref|NP_057457.1| WW domain-containing oxidoreductase isoform 1 [Homo sapiens]
          Length = 414

 Score =  139 bits (351), Expect = 4e-33
 Identities = 100/281 (35%), Positives = 130/281 (46%), Gaps = 4/281 (1%)
 Frame = +1

Query: 166 GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 345
           G+V +VTG   GIGF TAK  A  G HVI+A  N ++A EAV +I EE    KVE +  D
Sbjct: 124 GKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAMTLD 183

Query: 346 LASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXX 525
           LA ++S++ F + FK K +PLHVLV NA    +P   T+DG E  F VN+          
Sbjct: 184 LALLRSVQHFAEAFKAKNVPLHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLVQLL 243

Query: 526 XX---XXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQ-SSGGYSPHGAYTRSKLALVLF 693
                                       +G+LD   L  +   Y    AY RSKL  +LF
Sbjct: 244 QDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCNILF 303

Query: 694 SHRLQALLEAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGAWTSV 873
           S+ L   L  +G  VT+N   PG +        +W   LL  L    F K+  +GA T+V
Sbjct: 304 SNELHRRLSPRG--VTSNAVHPGNMMYSNIHRSWWVYTLLFTL-ARPFTKSMQQGAATTV 360

Query: 874 YAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARS 996
           Y A  P LEG+GG Y  N             +  R LWA S
Sbjct: 361 YCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALS 401


>ref|NP_612421.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Homo sapiens]
          Length = 260

 Score =  135 bits (340), Expect = 8e-32
 Identities = 89/252 (35%), Positives = 120/252 (47%), Gaps = 5/252 (1%)
 Frame = +1

Query: 274  KAREAVRKIREETLNDKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQR 453
            K   A + IR ETLN  V   + DLAS+KSIR+F  K   ++  + +L+NNAGVM  P  
Sbjct: 3    KCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCPHW 62

Query: 454  ETEDGFEEHFGVNYXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQ- 630
             TEDGFE  FGVN+              +                  H  G +D DDL  
Sbjct: 63   TTEDGFEMQFGVNHLGHFLLTNLLLDKLK----ASAPSRIINLSSLAHVAGHIDFDDLNW 118

Query: 631  SSGGYSPHGAYTRSKLALVLFSHRLQALLEAKGSPVTANVADPGVVNTDLYRHV-FWGTR 807
             +  Y+   AY +SKLA+VLF+  L   L+  GS VT N   PGV  T+L RH    G+ 
Sbjct: 119  QTRKYNTKAAYCQSKLAIVLFTKELSRRLQ--GSGVTVNALHPGVARTELGRHTGIHGST 176

Query: 808  LLKKLFG---WWFFKTPDEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQR 978
                  G   W   K+P+  A  S Y AV+  L  V G+Y    K+        D ++ R
Sbjct: 177  FSSTTLGPIFWLLVKSPELAAQPSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDEEVAR 236

Query: 979  QLWARSCQMTGI 1014
            +LWA S ++ G+
Sbjct: 237  RLWAESARLVGL 248


>ref|NP_653284.1| hypothetical protein LOC147015 [Homo sapiens]
          Length = 327

 Score =  100 bits (249), Expect = 3e-21
 Identities = 89/311 (28%), Positives = 131/311 (42%), Gaps = 4/311 (1%)
 Frame = +1

Query: 214  TAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCDLASMKSIRQFVQKFKM 393
            TA  LAR G  V++A  +  +   A   +R+E+ N++V F+  DLAS+ S+R F   F  
Sbjct: 2    TALELARRGARVVLACRSQERGEAAAFDLRQESGNNEVIFMALDLASLASVRAFATAFLS 61

Query: 394  KKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXXXXXXQXXXXXXXXXXX 573
             +  L +L++NAG+    +  T + F     VN+              +           
Sbjct: 62   SEPRLDILIHNAGISSCGR--TREAFNLLLRVNHIGPFLLTHLLLPCLKACAPSRVVVVA 119

Query: 574  XXXXXXXHYVGELDLDDLQSS--GGYSPHGAYTRSKLALVLFSHRLQALLEAKGSPVTAN 747
                   H  G LD   L     G      AY  +KLA VLF+  L   LEA G  VT  
Sbjct: 120  SAA----HCRGRLDFKRLDRPVVGWRQELRAYADTKLANVLFARELANQLEATG--VTCY 173

Query: 748  VADPGVVNTDLY-RHVFWGTRLLKKLFGWWFFKTPDEGAWTSVYAAVSPALEGVGGRYLY 924
             A PG VN++L+ RHV    R L +   W   + P  GA T +Y A+   +E + GRY  
Sbjct: 174  AAHPGPVNSELFLRHVPGWLRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYFA 233

Query: 925  NEKEAKSLAITYDPKLQRQLWARSCQMTGIADMTRDTLWG*RPRREDRVGPALAGASALD 1104
            N    +      D +   +LW  S ++ G+     D      P+ ED   P+       +
Sbjct: 234  NCHVEEVPPAARDDRAAHRLWEASKRLAGLGP-GEDAEPDEDPQSEDSEAPSSLSTPHPE 292

Query: 1105 RASASFP-PRP 1134
              + S P P P
Sbjct: 293  EPTVSQPYPSP 303


>ref|XP_371503.3| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 891

 Score = 71.6 bits (174), Expect = 1e-12
 Identities = 40/111 (36%), Positives = 65/111 (58%), Gaps = 1/111 (0%)
 Frame = +1

Query: 166 GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 345
           G++AIVTG   GIG   ++ LAR G  VI+   +    ++A+ +I+  + ++++     D
Sbjct: 602 GKIAIVTGANSGIGKVVSQDLARCGAQVILTCQSRECGQQALAEIQAASNSNRLLLGEVD 661

Query: 346 LASMKSIRQFVQKFKMKKIPLHVLVNNAGVM-MVPQRETEDGFEEHFGVNY 495
           L+SM SIR F ++   +   +H+LVNNAGV  M+P+  T  G +  F  NY
Sbjct: 662 LSSMTSIRSFARRLLQENPEIHLLVNNAGVSGMIPKTLTPGGLDLTFVTNY 712


>ref|XP_947127.1| PREDICTED: similar to short-chain dehydrogenase/reductase 1 [Homo
           sapiens]
          Length = 916

 Score = 71.6 bits (174), Expect = 1e-12
 Identities = 40/111 (36%), Positives = 65/111 (58%), Gaps = 1/111 (0%)
 Frame = +1

Query: 166 GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 345
           G++AIVTG   GIG   ++ LAR G  VI+   +    ++A+ +I+  + ++++     D
Sbjct: 627 GKIAIVTGANSGIGKVVSQDLARCGAQVILTCQSRECGQQALAEIQAASNSNRLLLGEVD 686

Query: 346 LASMKSIRQFVQKFKMKKIPLHVLVNNAGVM-MVPQRETEDGFEEHFGVNY 495
           L+SM SIR F ++   +   +H+LVNNAGV  M+P+  T  G +  F  NY
Sbjct: 687 LSSMTSIRSFARRLLQENPEIHLLVNNAGVSGMIPKTLTPGGLDLTFVTNY 737


>ref|NP_005785.1| dehydrogenase/reductase (SDR family) member 2 isoform 2 [Homo
           sapiens]
          Length = 280

 Score = 54.3 bits (129), Expect = 2e-07
 Identities = 60/225 (26%), Positives = 87/225 (38%), Gaps = 6/225 (2%)
 Frame = +1

Query: 169 RVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCDL 348
           RVA+VTG T GIGFA A+ LAR G HV+I+         A+ K++ E L+  V  + C +
Sbjct: 37  RVAVVTGSTSGIGFAIARRLARDGAHVVISSRKQQNVDRAMAKLQGEGLS--VAGIVCHV 94

Query: 349 ASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMV---PQRETEDGFEEHFGVNYXXXXXXXX 519
              +   Q V K       +  LV +AGV  +       +E  +++   VN         
Sbjct: 95  GKAEDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLS 154

Query: 520 XXXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSGGYSP---HGAYTRSKLALVL 690
                 +                            + S   Y+P    G Y  SK AL+ 
Sbjct: 155 QLLPYMENRRGAVIL--------------------VSSIAAYNPVVALGVYNVSKTALLG 194

Query: 691 FSHRLQALLEAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLF 825
            +  L   LE     +  N   PG++ TD +  VF G   L K F
Sbjct: 195 LTRTL--ALELAPKDIRVNCVVPGIIKTD-FSKVFHGNESLWKNF 236


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 46,211,470
Number of Sequences: 39411
Number of extensions: 1293109
Number of successful extensions: 8834
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 5857
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8701
length of database: 17,774,539
effective HSP length: 105
effective length of database: 13,636,384
effective search space used: 4650006944
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= OVRM1_0170_G05
         (1342 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_999238.1| 20-beta-hydroxysteroid dehydrogenase [Sus scrofa]     49   2e-07

>ref|NP_999238.1| 20-beta-hydroxysteroid dehydrogenase [Sus scrofa]
          Length = 289

 Score = 49.3 bits (116), Expect = 2e-07
 Identities = 30/90 (33%), Positives = 51/90 (56%), Gaps = 1/90 (1%)
 Frame = +1

Query: 169 RVAIVTGGTEGIGFATAKHLAR-LGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 345
           RVA+VTG  +GIGFA  + L R     V++   + ++ + AV++++ E L+ +  F   D
Sbjct: 6   RVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGLSPR--FHQLD 63

Query: 346 LASMKSIRQFVQKFKMKKIPLHVLVNNAGV 435
           +  ++SIR      + +   L VLVNNA +
Sbjct: 64  IIDLQSIRALCDFLRKEYGGLDVLVNNAAI 93


  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,045,468
Number of Sequences: 1040
Number of extensions: 26727
Number of successful extensions: 162
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 106
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 159
length of database: 434,620
effective HSP length: 80
effective length of database: 351,420
effective search space used: 128619720
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= OVRM1_0170_G05
         (1342 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001028498.1| dehydrogenase/reductase (SDR family) X chrom...   318   8e-87
Alignment   gi|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]            171   1e-42
Alignment   gi|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) ...   164   2e-40
Alignment   gi|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]              158   1e-38
Alignment   gi|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musc...   153   5e-37
Alignment   gi|NP_062519.2| WW-domain oxidoreductase [Mus musculus]              139   7e-33
Alignment   gi|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]          86   9e-17
Alignment   gi|NP_766635.1| carbonyl reductase 3 [Mus musculus]                   53   8e-07
Alignment   gi|NP_082066.1| dehydrogenase/reductase member 2 [Mus musculus]       52   1e-06
Alignment   gi|NP_062631.1| hydroxysteroid (17-beta) dehydrogenase 12 prote...    50   4e-06

>ref|NP_001028498.1| dehydrogenase/reductase (SDR family) X chromosome [Mus musculus]
          Length = 335

 Score =  318 bits (815), Expect = 8e-87
 Identities = 158/303 (52%), Positives = 201/303 (66%)
 Frame = +1

Query: 103  LAQLLRRCRGGFAEPVFPPQPGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAR 282
            LAQLLRR RG F  PV PPQPGRVAIVTG T GIG +TA+ LARLGM V++AGN++ + +
Sbjct: 22   LAQLLRRLRGDFRPPVLPPQPGRVAIVTGATAGIGRSTARQLARLGMCVVVAGNDEHRGQ 81

Query: 283  EAVRKIREETLNDKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETE 462
            E V  IR E  +D+  FL  DLAS+ S+R F + F+   +PLH+LVNNAGVM+ P+ ETE
Sbjct: 82   EVVSSIRAEMGSDRAHFLPLDLASLASVRGFARDFQALGLPLHLLVNNAGVMLEPRAETE 141

Query: 463  DGFEEHFGVNYXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSGG 642
            DGFE H GVN+              +                  HYVG +D+ DL     
Sbjct: 142  DGFERHLGVNFLGHFLLTLLLLPALRASGAEGRGSRVVTVGSATHYVGTVDMADLHGRHA 201

Query: 643  YSPHGAYTRSKLALVLFSHRLQALLEAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKL 822
            YSP+ AY +SKLAL LF+ +LQ +L+A+G PVT+N+ADPGVV+T+LYRH  W  R  K+ 
Sbjct: 202  YSPYAAYAQSKLALALFALQLQRILDARGDPVTSNMADPGVVDTELYRHAGWVLRTAKRF 261

Query: 823  FGWWFFKTPDEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQ 1002
             GW  FK+P+EGAWT VYAA +P LEGVGGRYL +E EA+ L    D +LQR+LWA   +
Sbjct: 262  LGWLVFKSPEEGAWTLVYAAAAPELEGVGGRYLRDEAEAEPLGTARDQELQRRLWAEGLR 321

Query: 1003 MTG 1011
            +TG
Sbjct: 322  LTG 324


>ref|NP_076186.1| alcohol dehydrogenase PAN2 [Mus musculus]
          Length = 334

 Score =  171 bits (434), Expect = 1e-42
 Identities = 110/295 (37%), Positives = 152/295 (51%), Gaps = 12/295 (4%)
 Frame = +1

Query: 166  GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETL---------- 315
            G+  ++TG   G+G ATA  L RLG  VI+   + ++A EA  ++R+E            
Sbjct: 44   GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRQELCQAGGAGPDGT 103

Query: 316  NDKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNY 495
            + ++     DLAS++S+R F Q+   ++  L VL+NNAGV   P  +TEDGFE  FGVN+
Sbjct: 104  DGQLVVKELDLASLRSVRAFCQELLQEEPRLDVLINNAGVFHCPYTKTEDGFEMQFGVNH 163

Query: 496  XXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSGGYSPHGAYTRSK 675
                          +                  +  GE++ +DL S   Y+    Y+RSK
Sbjct: 164  LGHFLLTNLLLGLLKSSAPSRIVVVSSKL----YKYGEINFEDLNSEQSYNKSFCYSRSK 219

Query: 676  LALVLFSHRLQALLEAKGSPVTANVADPGVVNTDLYRHVFWG--TRLLKKLFGWWFFKTP 849
            LA +LF+  L   LE  G+ VT NV  PG+V T+L RH+      R L  L  W FFKTP
Sbjct: 220  LANILFTRELARRLE--GTNVTVNVLHPGIVRTNLGRHIHIPLLARPLFNLVSWAFFKTP 277

Query: 850  DEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1014
             EGA TS+Y A SP +EGV GRY  + KE + L    D  + R+LW  S  M GI
Sbjct: 278  LEGAQTSIYLACSPDVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 332


>ref|NP_780581.1| retinol dehydrogenase 13 (all-trans and 9-cis) [Mus musculus]
          Length = 334

 Score =  164 bits (416), Expect = 2e-40
 Identities = 118/313 (37%), Positives = 149/313 (47%), Gaps = 11/313 (3%)
 Frame = +1

Query: 112  LLRRCRGGFAEPVFPPQPGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAV 291
            LL+    G A P     PG+  IVTG   GIG  TA  LA+ G +VI+A  +  K   A 
Sbjct: 20   LLKDYVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNVILACRDMEKCEVAA 79

Query: 292  RKIREETLNDKVEFLYCDLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGF 471
            + IR ETLN +V     DLAS+KSIR+F +K   ++  + +LVNNA VM  P   TEDGF
Sbjct: 80   KDIRGETLNPRVRAERLDLASLKSIREFARKVIKEEERVDILVNNAAVMRCPHWTTEDGF 139

Query: 472  EEHFGVNYXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQ-SSGGYS 648
            E  FGVNY              +                  H  G +D +DL      Y 
Sbjct: 140  EMQFGVNYLGHFLLTNLLLDKLK----ASAPSRIINLSSLAHVAGHIDFEDLNWQMKKYD 195

Query: 649  PHGAYTRSKLALVLF----SHRLQALLEAKGSPVTANVADPGVVNTDLYRH------VFW 798
               AY +SKLA+VLF    SHRLQ      GS VT N   PGV  T+L RH       F 
Sbjct: 196  TKAAYCQSKLAVVLFTKELSHRLQ------GSGVTVNALHPGVARTELGRHTGMHNSAFS 249

Query: 799  GTRLLKKLFGWWFFKTPDEGAWTSVYAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQR 978
            G  L    F W  FK+P   A  S Y AV+  LE V G+Y    +E        D ++ R
Sbjct: 250  GFML--GPFFWLLFKSPQLAAQPSTYLAVAEELENVSGKYFDGLREKAPSPEAEDEEVAR 307

Query: 979  QLWARSCQMTGIA 1017
            +LW  S ++ G+A
Sbjct: 308  RLWTESARLVGLA 320


>ref|NP_084293.1| retinol dehydrogenase 12 [Mus musculus]
          Length = 316

 Score =  158 bits (399), Expect = 1e-38
 Identities = 102/284 (35%), Positives = 147/284 (51%)
 Frame = +1

Query: 163  PGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYC 342
            PG+V ++TG   GIG  TA+ LAR G  V IA  +  K   A  +IR +T N +V     
Sbjct: 38   PGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKL 97

Query: 343  DLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXX 522
            DL+  KSIR F ++F  ++  LH+L+NNAGVMM P  +T DGFE HFGVN+         
Sbjct: 98   DLSDTKSIRAFAERFLAEEKKLHILINNAGVMMCPYSKTTDGFETHFGVNHLGHFLLTYL 157

Query: 523  XXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSGGYSPHGAYTRSKLALVLFSHR 702
                 +                  H +G++   DLQ    Y    AY  SKLA +LF+  
Sbjct: 158  LLERLK----ESAPARVVNLSSIAHLIGKIRFHDLQGQKRYCSAFAYGHSKLANLLFTRE 213

Query: 703  LQALLEAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGAWTSVYAA 882
            L   L+  G+ VTA    PGVV +++ R+ +    LL +LF   FFK+  +GA TS++ A
Sbjct: 214  LAKRLQ--GTGVTAYAVHPGVVLSEITRNSYL-LCLLWRLFS-PFFKSTSQGAQTSLHCA 269

Query: 883  VSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARSCQMTGI 1014
            ++  LE + G+Y  + K     +   + K   +LW  SC++ GI
Sbjct: 270  LAEDLEPLSGKYFSDCKRMWVSSRARNKKTAERLWNVSCELLGI 313


>ref|NP_067532.2| short-chain dehydrogenase/reductase 1 [Mus musculus]
          Length = 316

 Score =  153 bits (386), Expect = 5e-37
 Identities = 106/287 (36%), Positives = 147/287 (51%), Gaps = 3/287 (1%)
 Frame = +1

Query: 163  PGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYC 342
            PG+VAIVTG   GIG  TAK LA+ G  V +A  +  K   A R+I+  T N +V     
Sbjct: 37   PGKVAIVTGANTGIGKETAKDLAQRGARVYLACRDVDKGELAAREIQAVTGNSQVFVRKL 96

Query: 343  DLASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXX 522
            DLA  KSIR F + F  ++  LH+L+NNAGVMM P  +T DGFE H GVN+         
Sbjct: 97   DLADTKSIRAFAKDFLAEEKHLHLLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHL 156

Query: 523  XXXXXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQSSGGYSPHGAYTRSKLALVLFSHR 702
                 +                  H++G +   +LQ    YS   AY  SKLA +LF+  
Sbjct: 157  LLEKLK----ESAPSRIVNLSSLGHHLGRIHFHNLQGEKFYSAGLAYCHSKLANILFTKE 212

Query: 703  LQALLEAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGAWTSVYAA 882
            L   L  KGS VT     PG V+++L R+     R L +LF + F KTP EGA TS+Y A
Sbjct: 213  LAKRL--KGSGVTTYSVHPGTVHSELTRYSSI-MRWLWQLF-FVFIKTPQEGAQTSLYCA 268

Query: 883  VSPALEGVGGRYLYNEKEAKSLAITYDPK---LQRQLWARSCQMTGI 1014
            ++  LE + G +     + +   ++Y  +   + R+LW  SC + G+
Sbjct: 269  LTEGLESLSGSHF---SDCQLAWVSYQGRNEIIARRLWDVSCDLLGL 312


>ref|NP_062519.2| WW-domain oxidoreductase [Mus musculus]
          Length = 414

 Score =  139 bits (350), Expect = 7e-33
 Identities = 102/281 (36%), Positives = 130/281 (46%), Gaps = 4/281 (1%)
 Frame = +1

Query: 166 GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 345
           G+V +VTG   GIGF TAK  A  G HVI+A  N S+A EAV +I EE    KVE +  D
Sbjct: 124 GKVVLVTGANSGIGFETAKSFALHGAHVILACRNLSRASEAVSRILEEWHKAKVEAMTLD 183

Query: 346 LASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXX 525
           LA ++S++ F + FK K + LHVLV NAG   +P   T+DG E  F VN+          
Sbjct: 184 LAVLRSVQHFAEAFKAKNVSLHVLVCNAGTFALPWGLTKDGLETTFQVNHLGHFYLVQLL 243

Query: 526 XX---XXQXXXXXXXXXXXXXXXXXXHYVGELDLDDLQ-SSGGYSPHGAYTRSKLALVLF 693
                                        G+LDL  L      Y    AY RSKL  +LF
Sbjct: 244 QDVLCRSSPARVIVVSSESHRFTDINDSSGKLDLSRLSPPRSDYWAMLAYNRSKLCNILF 303

Query: 694 SHRLQALLEAKGSPVTANVADPGVVNTDLYRHVFWGTRLLKKLFGWWFFKTPDEGAWTSV 873
           S+ L   L  +G  VT+N   PG +         W  +LL  L    F K+  +GA T+V
Sbjct: 304 SNELHRRLSPRG--VTSNAVHPGNMMYSAIHRNSWVYKLLFTL-ARPFTKSMQQGAATTV 360

Query: 874 YAAVSPALEGVGGRYLYNEKEAKSLAITYDPKLQRQLWARS 996
           Y AV+P LEG+GG Y  N             +  R LW  S
Sbjct: 361 YCAVAPELEGLGGMYFNNCCRCLPSEEAQSEETARALWELS 401


>ref|NP_899109.1| hypothetical protein LOC70451 [Mus musculus]
          Length = 260

 Score = 85.9 bits (211), Expect = 9e-17
 Identities = 70/225 (31%), Positives = 100/225 (44%), Gaps = 3/225 (1%)
 Frame = +1

Query: 166 GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 345
           GR  +VTG   GIG  TA  LAR G  V++A  +  +   A   +R+E+ N++V F+  D
Sbjct: 36  GRTVVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALD 95

Query: 346 LASMKSIRQFVQKFKMKKIPLHVLVNNAGVMMVPQRETEDGFEEHFGVNYXXXXXXXXXX 525
           LAS+ S++ F   F   +  L VL++NAG+    +  T + F     VN+          
Sbjct: 96  LASLASVQAFATAFLSSEPRLDVLIHNAGISSCGR--TRETFNLLLRVNHVGPFLLTHLL 153

Query: 526 XXXXQXXXXXXXXXXXXXXXXXXHYVGELDLD--DLQSSGGYSPHGAYTRSKLALVLFSH 699
               +                  H  G LD    D    G      AY  SKLA VLF+ 
Sbjct: 154 LPRLR----SCAPSRVVIVSSAAHRRGRLDFTRLDCPVVGWQQELRAYADSKLANVLFAR 209

Query: 700 RLQALLEAKGSPVTANVADPGVVNTDLY-RHVFWGTRLLKKLFGW 831
            L   LE  G+ VT   A PG VN++L+ RH+    R + +   W
Sbjct: 210 ELATQLE--GTGVTCYAAHPGPVNSELFLRHLRGWLRPILRPLAW 252


>ref|NP_766635.1| carbonyl reductase 3 [Mus musculus]
          Length = 277

 Score = 52.8 bits (125), Expect = 8e-07
 Identities = 32/90 (35%), Positives = 53/90 (58%), Gaps = 1/90 (1%)
 Frame = +1

Query: 169 RVAIVTGGTEGIGFATAKHLAR-LGMHVIIAGNNDSKAREAVRKIREETLNDKVEFLYCD 345
           RVA+VTG  +GIGFA  + L R     V++   ++++ R AV++++ E L+ +  F   D
Sbjct: 6   RVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVQQLQAEGLSPR--FHQLD 63

Query: 346 LASMKSIRQFVQKFKMKKIPLHVLVNNAGV 435
           +   +SIR      + +   L+VLVNNAG+
Sbjct: 64  IDDPQSIRALRDFLRKEYGGLNVLVNNAGI 93


>ref|NP_082066.1| dehydrogenase/reductase member 2 [Mus musculus]
          Length = 282

 Score = 52.0 bits (123), Expect = 1e-06
 Identities = 24/51 (47%), Positives = 34/51 (66%)
 Frame = +1

Query: 166 GRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIREETLN 318
           G+VA++TG T GIGFA A+ LA+ G HV+I+        EAV  ++EE L+
Sbjct: 37  GKVAVITGSTRGIGFAIARRLAQDGAHVVISSRKQENVDEAVTILKEEGLS 87


>ref|NP_062631.1| hydroxysteroid (17-beta) dehydrogenase 12 protein [Mus musculus]
          Length = 312

 Score = 50.4 bits (119), Expect = 4e-06
 Identities = 34/104 (32%), Positives = 52/104 (50%), Gaps = 6/104 (5%)
 Frame = +1

Query: 142 EPVFPPQPGRVAIVTGGTEGIGFATAKHLARLGMHVIIAGNNDSKAREAVRKIRE----E 309
           E +  P+ G  A+VTGGT+GIG A A+ LA+ GM +++   +  K  +    I+E    E
Sbjct: 42  EALVGPRLGEWAVVTGGTDGIGKAYAEELAKRGMKIVLISRSQDKLNQVSNNIKEKFNVE 101

Query: 310 TLNDKVEFLYCDLASMKSIRQFVQKFK--MKKIPLHVLVNNAGV 435
           T    V+F         S+     K K  +  + + VLVNN G+
Sbjct: 102 TRTIAVDF---------SLDDIYDKIKTGLSGLEIGVLVNNVGM 136


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 53,558,947
Number of Sequences: 45328
Number of extensions: 1411738
Number of successful extensions: 8804
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 6131
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8689
length of database: 21,768,885
effective HSP length: 107
effective length of database: 16,918,789
effective search space used: 5735469471
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)