Animal-Genome cDNA TCH01_0052_H06


Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TCH01_0052_H06
         (1174 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_776447.1| clathrin, light polypeptide (Lca) [Bos taurus]       353   1e-97
Alignment   gi|NP_776702.1| clathrin, light polypeptide B (light chain B) [...   247   1e-65

>ref|NP_776447.1| clathrin, light polypeptide (Lca) [Bos taurus]
          Length = 243

 Score =  353 bits (906), Expect = 1e-97
 Identities = 189/243 (77%), Positives = 194/243 (79%), Gaps = 31/243 (12%)
 Frame = +1

Query: 208 MADLDPFGAPAG-PSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAFAILDXXXXXXXXX 384
           MA+LDPFG PAG P+LGNGVAGEEDPAAAFLAQQESEIAGIENDEAFAILD         
Sbjct: 1   MAELDPFGVPAGGPALGNGVAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGSQPH 60

Query: 385 XXXXXXXDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALD 564
                  DAVDGV NG+YYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALD
Sbjct: 61  GEPPGIPDAVDGVTNGDYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALD 120

Query: 565 ANSRKQEAEWKEKAMKELEEWYARQDEQLQKTKANNR----------------------- 675
           ANSRKQEAEWKEKA+KEL+EWYARQDEQLQKTKANNR                       
Sbjct: 121 ANSRKQEAEWKEKAIKELDEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYVTNINH 180

Query: 676 -------AAEEAFVNDIEESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAP 834
                  AAEEAFVNDIEESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAP
Sbjct: 181 PCYSLEQAAEEAFVNDIEESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAP 240

Query: 835 LVH 843
           LVH
Sbjct: 241 LVH 243


>ref|NP_776702.1| clathrin, light polypeptide B (light chain B) [Bos taurus]
          Length = 210

 Score =  247 bits (631), Expect = 1e-65
 Identities = 124/206 (60%), Positives = 147/206 (71%)
 Frame = +1

Query: 220 DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAFAILDXXXXXXXXXXXXXX 399
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F                  
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSQGGLAQPGPASG 62

Query: 400 XXDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALDANSRK 579
             + +   +NG+ +QE+NGP D YAAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+ 
Sbjct: 63  ASEDMGATVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKV 122

Query: 580 QEAEWKEKAMKELEEWYARQDEQLQKTKANNRAAEEAFVNDIEESSPGTEWERVARLCDF 759
            E EW+EKA K+LEEW  RQ EQ++K K NNRA+EEAFV + +E +PGTEWE+VA+LCDF
Sbjct: 123 MEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDF 182

Query: 760 NPKSSKQAKDVSRMRSVLISLKQAPL 837
           NPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 183 NPKSSKQCKDVSRLRSVLMSLKQTPL 208


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 29,880,168
Number of Sequences: 33508
Number of extensions: 672132
Number of successful extensions: 3164
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 2818
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3137
length of database: 16,112,626
effective HSP length: 103
effective length of database: 12,661,302
effective search space used: 3633793674
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TCH01_0052_H06
         (1174 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_866787.1| PREDICTED: similar to clathrin, light polypepti...   367   e-101
Alignment   gi|XP_866825.1| PREDICTED: similar to Clathrin light chain A (L...   357   2e-98
Alignment   gi|XP_866761.1| PREDICTED: similar to Clathrin light chain A (L...   356   3e-98
Alignment   gi|XP_531996.2| PREDICTED: similar to Clathrin light chain A (L...   351   7e-97
Alignment   gi|XP_866835.1| PREDICTED: similar to clathrin, light polypepti...   264   1e-70
Alignment   gi|XP_866115.1| PREDICTED: similar to clathrin, light polypepti...   244   2e-64
Alignment   gi|XP_866066.1| PREDICTED: similar to clathrin, light polypepti...   244   2e-64
Alignment   gi|XP_866083.1| PREDICTED: similar to clathrin, light polypepti...   243   2e-64
Alignment   gi|XP_866050.1| PREDICTED: similar to clathrin, light polypepti...   240   2e-63
Alignment   gi|XP_866801.1| PREDICTED: similar to Clathrin light chain A (L...   234   9e-62

>ref|XP_866787.1| PREDICTED: similar to clathrin, light polypeptide A isoform a
           isoform 3 [Canis familiaris]
          Length = 218

 Score =  367 bits (942), Expect = e-101
 Identities = 192/218 (88%), Positives = 196/218 (89%), Gaps = 6/218 (2%)
 Frame = +1

Query: 208 MADLDPFGAPA----GPSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 369
           MA+LDPFGAPA    GP+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGAPASAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP 60

Query: 370 XXXXXXXXXXXXDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER 549
                       DAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER
Sbjct: 61  GPQPHGEPPGVPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER 120

Query: 550 LEALDANSRKQEAEWKEKAMKELEEWYARQDEQLQKTKANNRAAEEAFVNDIEESSPGTE 729
           LEALDANSRKQEAEWKEKA+KELEEWYARQDEQLQKTKANNRAAEEAFVNDI+ESSPGTE
Sbjct: 121 LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTE 180

Query: 730 WERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH 843
           WERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
Sbjct: 181 WERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH 218


>ref|XP_866825.1| PREDICTED: similar to Clathrin light chain A (Lca) isoform 6 [Canis
           familiaris]
          Length = 230

 Score =  357 bits (915), Expect = 2e-98
 Identities = 191/230 (83%), Positives = 196/230 (85%), Gaps = 18/230 (7%)
 Frame = +1

Query: 208 MADLDPFGAPA----GPSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 369
           MA+LDPFGAPA    GP+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGAPASAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP 60

Query: 370 XXXXXXXXXXXXDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER 549
                       DAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER
Sbjct: 61  GPQPHGEPPGVPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER 120

Query: 550 LEALDANSRKQEAEWKEKAMKELEEWYARQDEQLQKTKANN------------RAAEEAF 693
           LEALDANSRKQEAEWKEKA+KELEEWYARQDEQLQKTKANN            +AAEEAF
Sbjct: 121 LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNSTNINHPCYSLEQAAEEAF 180

Query: 694 VNDIEESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH 843
           VNDI+ESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
Sbjct: 181 VNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH 230


>ref|XP_866761.1| PREDICTED: similar to Clathrin light chain A (Lca) isoform 2 [Canis
           familiaris]
          Length = 236

 Score =  356 bits (913), Expect = 3e-98
 Identities = 192/236 (81%), Positives = 196/236 (83%), Gaps = 24/236 (10%)
 Frame = +1

Query: 208 MADLDPFGAPA----GPSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 369
           MA+LDPFGAPA    GP+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGAPASAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP 60

Query: 370 XXXXXXXXXXXXDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER 549
                       DAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER
Sbjct: 61  GPQPHGEPPGVPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER 120

Query: 550 LEALDANSRKQEAEWKEKAMKELEEWYARQDEQLQKTKANNR------------------ 675
           LEALDANSRKQEAEWKEKA+KELEEWYARQDEQLQKTKANNR                  
Sbjct: 121 LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYV 180

Query: 676 AAEEAFVNDIEESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH 843
           AAEEAFVNDI+ESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
Sbjct: 181 AAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH 236


>ref|XP_531996.2| PREDICTED: similar to Clathrin light chain A (Lca) isoform 1 [Canis
           familiaris]
          Length = 248

 Score =  351 bits (901), Expect = 7e-97
 Identities = 192/248 (77%), Positives = 196/248 (79%), Gaps = 36/248 (14%)
 Frame = +1

Query: 208 MADLDPFGAPA----GPSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 369
           MA+LDPFGAPA    GP+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGAPASAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP 60

Query: 370 XXXXXXXXXXXXDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER 549
                       DAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER
Sbjct: 61  GPQPHGEPPGVPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER 120

Query: 550 LEALDANSRKQEAEWKEKAMKELEEWYARQDEQLQKTKANNR------------------ 675
           LEALDANSRKQEAEWKEKA+KELEEWYARQDEQLQKTKANNR                  
Sbjct: 121 LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYV 180

Query: 676 ------------AAEEAFVNDIEESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS 819
                       AAEEAFVNDI+ESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS
Sbjct: 181 TNINHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS 240

Query: 820 LKQAPLVH 843
           LKQAPLVH
Sbjct: 241 LKQAPLVH 248


>ref|XP_866835.1| PREDICTED: similar to clathrin, light polypeptide A isoform a
           isoform 7 [Canis familiaris]
          Length = 139

 Score =  264 bits (675), Expect = 1e-70
 Identities = 131/134 (97%), Positives = 134/134 (100%)
 Frame = +1

Query: 442 QESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAMKELE 621
           +ESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKA+KELE
Sbjct: 6   RESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELE 65

Query: 622 EWYARQDEQLQKTKANNRAAEEAFVNDIEESSPGTEWERVARLCDFNPKSSKQAKDVSRM 801
           EWYARQDEQLQKTKANNRAAEEAFVNDI+ESSPGTEWERVARLCDFNPKSSKQAKDVSRM
Sbjct: 66  EWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRM 125

Query: 802 RSVLISLKQAPLVH 843
           RSVLISLKQAPLVH
Sbjct: 126 RSVLISLKQAPLVH 139


>ref|XP_866115.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           5 [Canis familiaris]
          Length = 211

 Score =  244 bits (622), Expect = 2e-64
 Identities = 125/207 (60%), Positives = 148/207 (71%), Gaps = 1/207 (0%)
 Frame = +1

Query: 220 DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAF-AILDXXXXXXXXXXXXX 396
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F A                
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAALAQPGPAGG 62

Query: 397 XXXDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALDANSR 576
              + +   +NG+ +QE+NGP D YAAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+
Sbjct: 63  AGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASK 122

Query: 577 KQEAEWKEKAMKELEEWYARQDEQLQKTKANNRAAEEAFVNDIEESSPGTEWERVARLCD 756
             E EW+EKA K+LEEW  RQ EQ++K K NNRA+EEAFV + +E +PGTEWE+VA+LCD
Sbjct: 123 VTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCD 182

Query: 757 FNPKSSKQAKDVSRMRSVLISLKQAPL 837
           FNPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 183 FNPKSSKQCKDVSRLRSVLMSLKQTPL 209


>ref|XP_866066.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           3 [Canis familiaris]
          Length = 207

 Score =  244 bits (622), Expect = 2e-64
 Identities = 124/206 (60%), Positives = 149/206 (72%)
 Frame = +1

Query: 220 DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAFAILDXXXXXXXXXXXXXX 399
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F + +              
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGLSNGYCHVFVLSLAGS- 61

Query: 400 XXDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALDANSRK 579
             + +   +NG+ +QE+NGP D YAAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+ 
Sbjct: 62  --EDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKV 119

Query: 580 QEAEWKEKAMKELEEWYARQDEQLQKTKANNRAAEEAFVNDIEESSPGTEWERVARLCDF 759
            E EW+EKA K+LEEW  RQ EQ++K K NNRA+EEAFV + +E +PGTEWE+VA+LCDF
Sbjct: 120 TEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDF 179

Query: 760 NPKSSKQAKDVSRMRSVLISLKQAPL 837
           NPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 180 NPKSSKQCKDVSRLRSVLMSLKQTPL 205


>ref|XP_866083.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           4 [Canis familiaris]
          Length = 213

 Score =  243 bits (621), Expect = 2e-64
 Identities = 124/209 (59%), Positives = 147/209 (70%), Gaps = 3/209 (1%)
 Frame = +1

Query: 220 DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAFAILDXXXXXXXXXXX--- 390
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F                  
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAALAHASACPP 62

Query: 391 XXXXXDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALDAN 570
                + +   +NG+ +QE+NGP D YAAI+Q DRL  EPESIRKWREEQ +RL+ LDA 
Sbjct: 63  STAGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA 122

Query: 571 SRKQEAEWKEKAMKELEEWYARQDEQLQKTKANNRAAEEAFVNDIEESSPGTEWERVARL 750
           S+  E EW+EKA K+LEEW  RQ EQ++K K NNRA+EEAFV + +E +PGTEWE+VA+L
Sbjct: 123 SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL 182

Query: 751 CDFNPKSSKQAKDVSRMRSVLISLKQAPL 837
           CDFNPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 183 CDFNPKSSKQCKDVSRLRSVLMSLKQTPL 211


>ref|XP_866050.1| PREDICTED: similar to clathrin, light polypeptide isoform a isoform
           2 [Canis familiaris]
          Length = 208

 Score =  240 bits (612), Expect = 2e-63
 Identities = 124/206 (60%), Positives = 146/206 (70%)
 Frame = +1

Query: 220 DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAFAILDXXXXXXXXXXXXXX 399
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F                  
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGA--PAGNSGEEEGPRYG 60

Query: 400 XXDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALDANSRK 579
               +   +NG+ +QE+NGP D YAAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+ 
Sbjct: 61  PLGDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKV 120

Query: 580 QEAEWKEKAMKELEEWYARQDEQLQKTKANNRAAEEAFVNDIEESSPGTEWERVARLCDF 759
            E EW+EKA K+LEEW  RQ EQ++K K NNRA+EEAFV + +E +PGTEWE+VA+LCDF
Sbjct: 121 TEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDF 180

Query: 760 NPKSSKQAKDVSRMRSVLISLKQAPL 837
           NPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 181 NPKSSKQCKDVSRLRSVLMSLKQTPL 206


>ref|XP_866801.1| PREDICTED: similar to Clathrin light chain A (Lca) isoform 4 [Canis
           familiaris]
          Length = 178

 Score =  234 bits (598), Expect = 9e-62
 Identities = 143/230 (62%), Positives = 150/230 (65%), Gaps = 18/230 (7%)
 Frame = +1

Query: 208 MADLDPFGAPA----GPSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 369
           MA+LDPFGAPA    GP+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAIL     
Sbjct: 1   MAELDPFGAPASAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAIL----- 55

Query: 370 XXXXXXXXXXXXDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER 549
                          DG   G                    +   EP  +          
Sbjct: 56  ---------------DGGAPGP-------------------QPHGEPPGVP--------- 72

Query: 550 LEALDANSRKQEAEWKEKAMKELEEWYARQDEQLQKTKANN------------RAAEEAF 693
               DANSRKQEAEWKEKA+KELEEWYARQDEQLQKTKANN            +AAEEAF
Sbjct: 73  ----DANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNSTNINHPCYSLEQAAEEAF 128

Query: 694 VNDIEESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH 843
           VNDI+ESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
Sbjct: 129 VNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH 178


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 35,133,546
Number of Sequences: 33732
Number of extensions: 790175
Number of successful extensions: 4022
Number of sequences better than 1.0e-05: 10
Number of HSP's better than  0.0 without gapping: 3405
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3940
length of database: 19,266,565
effective HSP length: 105
effective length of database: 15,724,705
effective search space used: 4481540925
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TCH01_0052_H06
         (1174 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001824.1| clathrin, light polypeptide A isoform a [Homo s...   365   e-101
Alignment   gi|NP_009027.1| clathrin, light polypeptide A isoform b [Homo s...   349   3e-96
Alignment   gi|NP_001825.1| clathrin, light polypeptide isoform a [Homo sap...   244   1e-64
Alignment   gi|NP_009028.1| clathrin, light polypeptide isoform b [Homo sap...   233   3e-61

>ref|NP_001824.1| clathrin, light polypeptide A isoform a [Homo sapiens]
          Length = 218

 Score =  365 bits (936), Expect = e-101
 Identities = 191/218 (87%), Positives = 195/218 (89%), Gaps = 6/218 (2%)
 Frame = +1

Query: 208 MADLDPFGAPAG----PSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 369
           MA+LDPFGAPAG    P+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP 60

Query: 370 XXXXXXXXXXXXDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER 549
                       DAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQ ER
Sbjct: 61  GPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMER 120

Query: 550 LEALDANSRKQEAEWKEKAMKELEEWYARQDEQLQKTKANNRAAEEAFVNDIEESSPGTE 729
           LEALDANSRKQEAEWKEKA+KELEEWYARQDEQLQKTKANNRAAEEAFVNDI+ESSPGTE
Sbjct: 121 LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTE 180

Query: 730 WERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH 843
           WERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
Sbjct: 181 WERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH 218


>ref|NP_009027.1| clathrin, light polypeptide A isoform b [Homo sapiens]
          Length = 248

 Score =  349 bits (895), Expect = 3e-96
 Identities = 191/248 (77%), Positives = 195/248 (78%), Gaps = 36/248 (14%)
 Frame = +1

Query: 208 MADLDPFGAPAG----PSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 369
           MA+LDPFGAPAG    P+LGNGVAG  EEDPAAAFLAQQESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP 60

Query: 370 XXXXXXXXXXXXDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER 549
                       DAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQ ER
Sbjct: 61  GPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMER 120

Query: 550 LEALDANSRKQEAEWKEKAMKELEEWYARQDEQLQKTKANNR------------------ 675
           LEALDANSRKQEAEWKEKA+KELEEWYARQDEQLQKTKANNR                  
Sbjct: 121 LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYV 180

Query: 676 ------------AAEEAFVNDIEESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS 819
                       AAEEAFVNDI+ESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS
Sbjct: 181 TNINHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS 240

Query: 820 LKQAPLVH 843
           LKQAPLVH
Sbjct: 241 LKQAPLVH 248


>ref|NP_001825.1| clathrin, light polypeptide isoform a [Homo sapiens]
          Length = 211

 Score =  244 bits (622), Expect = 1e-64
 Identities = 125/207 (60%), Positives = 148/207 (71%), Gaps = 1/207 (0%)
 Frame = +1

Query: 220 DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAF-AILDXXXXXXXXXXXXX 396
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F A                
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSG 62

Query: 397 XXXDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALDANSR 576
              + +   +NG+ +QE+NGP D YAAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+
Sbjct: 63  AGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASK 122

Query: 577 KQEAEWKEKAMKELEEWYARQDEQLQKTKANNRAAEEAFVNDIEESSPGTEWERVARLCD 756
             E EW+EKA K+LEEW  RQ EQ++K K NNRA+EEAFV + +E +PGTEWE+VA+LCD
Sbjct: 123 VTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCD 182

Query: 757 FNPKSSKQAKDVSRMRSVLISLKQAPL 837
           FNPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 183 FNPKSSKQCKDVSRLRSVLMSLKQTPL 209


>ref|NP_009028.1| clathrin, light polypeptide isoform b [Homo sapiens]
          Length = 229

 Score =  233 bits (593), Expect = 3e-61
 Identities = 125/225 (55%), Positives = 148/225 (65%), Gaps = 19/225 (8%)
 Frame = +1

Query: 220 DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAF-AILDXXXXXXXXXXXXX 396
           D FG  +    G   A EEDPAAAFLAQQESEIAGIENDE F A                
Sbjct: 3   DDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSG 62

Query: 397 XXXDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALDANSR 576
              + +   +NG+ +QE+NGP D YAAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+
Sbjct: 63  AGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASK 122

Query: 577 KQEAEWKEKAMKELEEWYARQDEQLQKTKANNR------------------AAEEAFVND 702
             E EW+EKA K+LEEW  RQ EQ++K K NNR                  A+EEAFV +
Sbjct: 123 VTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFVKE 182

Query: 703 IEESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPL 837
            +E +PGTEWE+VA+LCDFNPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 183 SKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPL 227


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 33,784,490
Number of Sequences: 39411
Number of extensions: 779279
Number of successful extensions: 3974
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 3302
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3893
length of database: 17,774,539
effective HSP length: 104
effective length of database: 13,675,795
effective search space used: 3911277370
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TCH01_0052_H06
         (1174 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 800,639
Number of Sequences: 1040
Number of extensions: 17575
Number of successful extensions: 81
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 70
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 78
length of database: 434,620
effective HSP length: 79
effective length of database: 352,460
effective search space used: 109615060
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TCH01_0052_H06
         (1174 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_058040.1| clathrin, light polypeptide (Lca) [Mus musculus]     346   3e-95
Alignment   gi|NP_083146.1| clathrin, light polypeptide (Lcb) [Mus musculus]     241   1e-63

>ref|NP_058040.1| clathrin, light polypeptide (Lca) [Mus musculus]
          Length = 235

 Score =  346 bits (887), Expect = 3e-95
 Identities = 187/236 (79%), Positives = 193/236 (81%), Gaps = 24/236 (10%)
 Frame = +1

Query: 208 MADLDPFG----APAGPSLGNGVAG--EEDPAAAFLAQQESEIAGIENDEAFAILDXXXX 369
           MA+LDPFG    AP GP+LGNGVAG  EEDPAAAFLA +ESEIAGIENDEAFAILD    
Sbjct: 1   MAELDPFGDPAGAPGGPALGNGVAGAGEEDPAAAFLAHEESEIAGIENDEAFAILDGGAP 60

Query: 370 XXXXXXXXXXXXDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER 549
                       DAVDGVMNGEYYQESNGPTDSYAAIS+VDRLQSEPESIRKWREEQTER
Sbjct: 61  GRATRRAGGGP-DAVDGVMNGEYYQESNGPTDSYAAISEVDRLQSEPESIRKWREEQTER 119

Query: 550 LEALDANSRKQEAEWKEKAMKELEEWYARQDEQLQKTKANNR------------------ 675
           LEALDANSRKQEAEWKEKA+KELEEWYARQDEQLQKTKANNR                  
Sbjct: 120 LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFYKQPFADVIGYV 179

Query: 676 AAEEAFVNDIEESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH 843
           AAEEAFVNDI+ESSPGTEWERVA LCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
Sbjct: 180 AAEEAFVNDIDESSPGTEWERVAPLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH 235


>ref|NP_083146.1| clathrin, light polypeptide (Lcb) [Mus musculus]
          Length = 211

 Score =  241 bits (614), Expect = 1e-63
 Identities = 123/207 (59%), Positives = 147/207 (71%), Gaps = 1/207 (0%)
 Frame = +1

Query: 220 DPFGAPAGPSLGNGVAGEEDPAAAFLAQQESEIAGIENDEAF-AILDXXXXXXXXXXXXX 396
           + FG  +    G   A EEDPAAAFLAQQESEIAGIEND  F A                
Sbjct: 3   EDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDPGFGAPAASQVASAQPGLASG 62

Query: 397 XXXDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALDANSR 576
              + +   +NG+ +QE+NGP D YAAI+Q DRL  EPESIRKWREEQ +RL+ LDA S+
Sbjct: 63  AGSEDMSTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQKKRLQELDAASK 122

Query: 577 KQEAEWKEKAMKELEEWYARQDEQLQKTKANNRAAEEAFVNDIEESSPGTEWERVARLCD 756
             E EW+EKA K+LEEW  RQ EQ++K K NNRA+EEAFV + +E +PGTEWE+VA+LCD
Sbjct: 123 VTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCD 182

Query: 757 FNPKSSKQAKDVSRMRSVLISLKQAPL 837
           FNPKSSKQ KDVSR+RSVL+SLKQ PL
Sbjct: 183 FNPKSSKQCKDVSRLRSVLMSLKQTPL 209


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 40,149,306
Number of Sequences: 45328
Number of extensions: 895574
Number of successful extensions: 4555
Number of sequences better than 1.0e-05: 2
Number of HSP's better than  0.0 without gapping: 3719
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4423
length of database: 21,768,885
effective HSP length: 105
effective length of database: 17,009,445
effective search space used: 4847691825
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)