Animal-Genome cDNA TCH01_0075_F01


Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TCH01_0075_F01
         (2310 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_604169.2| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   277   3e-74
Alignment   gi|XP_613987.2| PREDICTED: similar to NADP-dependent malic enzy...   272   1e-72
Alignment   gi|XP_875137.1| PREDICTED: similar to NAD-dependent malic enzym...   159   9e-39
Alignment   gi|XP_584500.2| PREDICTED: similar to NAD-dependent malic enzym...    66   1e-10

>ref|XP_604169.2| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial [Bos taurus]
          Length = 564

 Score =  277 bits (708), Expect = 3e-74
 Identities = 141/158 (89%), Positives = 142/158 (89%)
 Frame = +3

Query: 3   SSLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCY 182
           +SLEEVVRLVKPT           FTEQILRDMASFHE PIIFALSNPTSKAECTAEKCY
Sbjct: 328 NSLEEVVRLVKPTAIIGVAAIAGAFTEQILRDMASFHEHPIIFALSNPTSKAECTAEKCY 387

Query: 183 RVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLT 362
           RVTEGRGIFASGSPF SVTLEDGRTF PGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLT
Sbjct: 388 RVTEGRGIFASGSPFPSVTLEDGRTFFPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLT 447

Query: 363 AEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLD 476
           AEQIAQEVSE HLSQGRLYPPLSTIRDVSLRIAIKV D
Sbjct: 448 AEQIAQEVSEHHLSQGRLYPPLSTIRDVSLRIAIKVRD 485


>ref|XP_613987.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Bos taurus]
          Length = 472

 Score =  272 bits (695), Expect = 1e-72
 Identities = 130/205 (63%), Positives = 161/205 (78%)
 Frame = +3

Query: 6   SLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 185
           +LE +V+ +KPT           F+EQI++DMA+F+ERPIIFALSNPTSKAECTAE+CY+
Sbjct: 264 NLEAIVQDIKPTALIGVAAIGGAFSEQIIKDMAAFNERPIIFALSNPTSKAECTAEQCYK 323

Query: 186 VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA 365
           +T+GR IFASGSPF  VTL  G+T  PGQGNN+YVFPGVALGV+A G+RHI D+IFL TA
Sbjct: 324 LTKGRAIFASGSPFDPVTLPSGKTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTTA 383

Query: 366 EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRS 545
           E IAQ+VS++HL +GRLYPPL TIRDVSL+IA K++  AY+   A+ YPEP +KEAFVRS
Sbjct: 384 EVIAQQVSDKHLEEGRLYPPLDTIRDVSLKIAEKIVKDAYQEKTATVYPEPPNKEAFVRS 443

Query: 546 LVYTPDYDSFTLDSYTWPKEAMNVQ 620
            +Y+ DYD    D Y WPKEA  +Q
Sbjct: 444 QMYSTDYDQILPDCYPWPKEAQKIQ 468


>ref|XP_875137.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2), partial [Bos
           taurus]
          Length = 152

 Score =  159 bits (402), Expect = 9e-39
 Identities = 72/139 (51%), Positives = 99/139 (71%)
 Frame = +3

Query: 192 EGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTAEQ 371
           +GR +FASGSPF+ V L DG+ F PGQGNN Y+FPGVAL VI    RHI D +FL  A+ 
Sbjct: 6   QGRCLFASGSPFEPVKLSDGQVFTPGQGNNVYIFPGVALAVILCNTRHISDHVFLEAAKA 65

Query: 372 IAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLV 551
           +  +++++ L+QGRLYPPLS I++VS+ IAIKV +Y Y + +A  YPEP+DK  ++R  +
Sbjct: 66  LTSQLTDKELAQGRLYPPLSNIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYIRERI 125

Query: 552 YTPDYDSFTLDSYTWPKEA 608
           +  +YDS   D Y WP+ A
Sbjct: 126 WRSEYDSLLPDVYEWPEAA 144


>ref|XP_584500.2| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2), partial [Bos
           taurus]
          Length = 513

 Score = 65.9 bits (159), Expect = 1e-10
 Identities = 30/63 (47%), Positives = 42/63 (66%)
 Frame = +3

Query: 6   SLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 185
           + EE V ++KP+           FT  +++ MA  +ERPIIFALSNPT++AECTAE+ Y 
Sbjct: 451 TFEEAVNILKPSAIIGVAGAGRLFTPGVIKAMAEINERPIIFALSNPTAQAECTAEEAYT 510

Query: 186 VTE 194
           +TE
Sbjct: 511 LTE 513


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 82,678,419
Number of Sequences: 33508
Number of extensions: 2315722
Number of successful extensions: 7475
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 5922
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7467
length of database: 16,112,626
effective HSP length: 109
effective length of database: 12,460,254
effective search space used: 8223767640
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TCH01_0075_F01
         (2310 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_542269.2| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   389   e-108
Alignment   gi|XP_857227.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   389   e-108
Alignment   gi|XP_857091.1| PREDICTED: similar to NADP-dependent malic enzy...   389   e-108
Alignment   gi|XP_848770.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   389   e-108
Alignment   gi|XP_857135.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   374   e-103
Alignment   gi|XP_857177.1| PREDICTED: similar to malic enzyme 3, NADP(+)-d...   322   8e-88
Alignment   gi|XP_532217.2| PREDICTED: similar to NADP-dependent malic enzy...   273   5e-73
Alignment   gi|XP_849530.1| PREDICTED: similar to NAD-dependent malic enzym...   217   3e-56
Alignment   gi|XP_533402.2| PREDICTED: similar to NAD-dependent malic enzym...   217   3e-56

>ref|XP_542269.2| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 1 [Canis familiaris]
          Length = 569

 Score =  389 bits (998), Expect = e-108
 Identities = 194/207 (93%), Positives = 195/207 (94%)
 Frame = +3

Query: 6   SLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 185
           SLEEVVRLVKPT           FTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR
Sbjct: 363 SLEEVVRLVKPTAIIGVAAIAGAFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 422

Query: 186 VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA 365
           VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA
Sbjct: 423 VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA 482

Query: 366 EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRS 545
           EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLD+AYKHNLASYYPEPKDKEAFVRS
Sbjct: 483 EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDFAYKHNLASYYPEPKDKEAFVRS 542

Query: 546 LVYTPDYDSFTLDSYTWPKEAMNVQNV 626
           LVYTPDYDSFTLDSYTWPKEAMNVQ V
Sbjct: 543 LVYTPDYDSFTLDSYTWPKEAMNVQTV 569


>ref|XP_857227.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 7 [Canis familiaris]
          Length = 562

 Score =  389 bits (998), Expect = e-108
 Identities = 194/207 (93%), Positives = 195/207 (94%)
 Frame = +3

Query: 6   SLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 185
           SLEEVVRLVKPT           FTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR
Sbjct: 356 SLEEVVRLVKPTAIIGVAAIAGAFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 415

Query: 186 VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA 365
           VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA
Sbjct: 416 VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA 475

Query: 366 EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRS 545
           EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLD+AYKHNLASYYPEPKDKEAFVRS
Sbjct: 476 EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDFAYKHNLASYYPEPKDKEAFVRS 535

Query: 546 LVYTPDYDSFTLDSYTWPKEAMNVQNV 626
           LVYTPDYDSFTLDSYTWPKEAMNVQ V
Sbjct: 536 LVYTPDYDSFTLDSYTWPKEAMNVQTV 562


>ref|XP_857091.1| PREDICTED: similar to NADP-dependent malic enzyme, mitochondrial
           precursor (NADP-ME) (Malic enzyme 3) isoform 4 [Canis
           familiaris]
          Length = 231

 Score =  389 bits (998), Expect = e-108
 Identities = 194/207 (93%), Positives = 195/207 (94%)
 Frame = +3

Query: 6   SLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 185
           SLEEVVRLVKPT           FTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR
Sbjct: 25  SLEEVVRLVKPTAIIGVAAIAGAFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 84

Query: 186 VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA 365
           VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA
Sbjct: 85  VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA 144

Query: 366 EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRS 545
           EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLD+AYKHNLASYYPEPKDKEAFVRS
Sbjct: 145 EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDFAYKHNLASYYPEPKDKEAFVRS 204

Query: 546 LVYTPDYDSFTLDSYTWPKEAMNVQNV 626
           LVYTPDYDSFTLDSYTWPKEAMNVQ V
Sbjct: 205 LVYTPDYDSFTLDSYTWPKEAMNVQTV 231


>ref|XP_848770.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
            mitochondrial isoform 2 [Canis familiaris]
          Length = 604

 Score =  389 bits (998), Expect = e-108
 Identities = 194/207 (93%), Positives = 195/207 (94%)
 Frame = +3

Query: 6    SLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 185
            SLEEVVRLVKPT           FTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR
Sbjct: 398  SLEEVVRLVKPTAIIGVAAIAGAFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 457

Query: 186  VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA 365
            VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA
Sbjct: 458  VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA 517

Query: 366  EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRS 545
            EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLD+AYKHNLASYYPEPKDKEAFVRS
Sbjct: 518  EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDFAYKHNLASYYPEPKDKEAFVRS 577

Query: 546  LVYTPDYDSFTLDSYTWPKEAMNVQNV 626
            LVYTPDYDSFTLDSYTWPKEAMNVQ V
Sbjct: 578  LVYTPDYDSFTLDSYTWPKEAMNVQTV 604


>ref|XP_857135.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
            mitochondrial isoform 5 [Canis familiaris]
          Length = 573

 Score =  374 bits (959), Expect = e-103
 Identities = 194/235 (82%), Positives = 195/235 (82%), Gaps = 28/235 (11%)
 Frame = +3

Query: 6    SLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 185
            SLEEVVRLVKPT           FTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR
Sbjct: 339  SLEEVVRLVKPTAIIGVAAIAGAFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 398

Query: 186  VTE----------------------------GRGIFASGSPFKSVTLEDGRTFIPGQGNN 281
            VTE                            GRGIFASGSPFKSVTLEDGRTFIPGQGNN
Sbjct: 399  VTEVSGESFLPQAERTYPSSYHHVILFRVPLGRGIFASGSPFKSVTLEDGRTFIPGQGNN 458

Query: 282  AYVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIA 461
            AYVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIA
Sbjct: 459  AYVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIA 518

Query: 462  IKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQNV 626
            IKVLD+AYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQ V
Sbjct: 519  IKVLDFAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV 573


>ref|XP_857177.1| PREDICTED: similar to malic enzyme 3, NADP(+)-dependent,
           mitochondrial isoform 6 [Canis familiaris]
          Length = 513

 Score =  322 bits (826), Expect = 8e-88
 Identities = 167/207 (80%), Positives = 170/207 (82%)
 Frame = +3

Query: 6   SLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 185
           SLEEVVRLVKPT                               +     +AECTAEKCYR
Sbjct: 336 SLEEVVRLVKPTAI-----------------------------IGRRRQEAECTAEKCYR 366

Query: 186 VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA 365
           VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA
Sbjct: 367 VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA 426

Query: 366 EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRS 545
           EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLD+AYKHNLASYYPEPKDKEAFVRS
Sbjct: 427 EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDFAYKHNLASYYPEPKDKEAFVRS 486

Query: 546 LVYTPDYDSFTLDSYTWPKEAMNVQNV 626
           LVYTPDYDSFTLDSYTWPKEAMNVQ V
Sbjct: 487 LVYTPDYDSFTLDSYTWPKEAMNVQTV 513


>ref|XP_532217.2| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
            enzyme 1) [Canis familiaris]
          Length = 634

 Score =  273 bits (698), Expect = 5e-73
 Identities = 131/205 (63%), Positives = 161/205 (78%)
 Frame = +3

Query: 6    SLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 185
            +LE +V+ +KPT           F+EQIL+DMA+F+ERPIIFALSNPTSKAECTAE+CY+
Sbjct: 425  NLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYK 484

Query: 186  VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA 365
            +T+GR IFASGSPF  VTL +GRT  PGQGNN+YVFPGVALGV+A G+RHI D IFL TA
Sbjct: 485  LTKGRAIFASGSPFDPVTLPNGRTLYPGQGNNSYVFPGVALGVVACGLRHITDNIFLTTA 544

Query: 366  EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRS 545
            E IAQ+VS++HL +GRLYPPL TIRDVSL+IA K++  AY+   A+ YPEP +KEAFVRS
Sbjct: 545  EIIAQQVSDKHLEEGRLYPPLDTIRDVSLKIAAKIVKDAYQEKTATVYPEPPNKEAFVRS 604

Query: 546  LVYTPDYDSFTLDSYTWPKEAMNVQ 620
             +Y  DYD    D Y+WP+EA  +Q
Sbjct: 605  QMYDTDYDQILPDCYSWPEEAQKIQ 629


>ref|XP_849530.1| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) isoform 2 [Canis
           familiaris]
          Length = 584

 Score =  217 bits (553), Expect = 3e-56
 Identities = 99/203 (48%), Positives = 142/203 (69%)
 Frame = +3

Query: 6   SLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 185
           + E+ V +++P+           FT  +++ MA  +ERP+IFALSNPT+ AECTAE+ Y 
Sbjct: 376 TFEDAVNILRPSAIIGVAGAGRLFTPGVIKAMADINERPVIFALSNPTAMAECTAEEAYT 435

Query: 186 VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA 365
           +TEGR +FASGSPF+ V L DG+ F PGQGNN Y+FPGVAL VI    RHI D +FL  A
Sbjct: 436 LTEGRCLFASGSPFEPVKLSDGQLFTPGQGNNVYIFPGVALAVILCNTRHISDHVFLEAA 495

Query: 366 EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRS 545
           + +A +++++ L+QGRLYPPL+ I++VS+ IAIKV +Y Y + +A  YPEP+DK  ++R 
Sbjct: 496 KALANQLTDKELAQGRLYPPLADIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYIRE 555

Query: 546 LVYTPDYDSFTLDSYTWPKEAMN 614
            ++  +YDS   D Y WP+ A++
Sbjct: 556 RIWRSEYDSLLPDVYDWPESALS 578


>ref|XP_533402.2| PREDICTED: similar to NAD-dependent malic enzyme, mitochondrial
           precursor (NAD-ME) (Malic enzyme 2) isoform 1 [Canis
           familiaris]
          Length = 499

 Score =  217 bits (553), Expect = 3e-56
 Identities = 99/203 (48%), Positives = 142/203 (69%)
 Frame = +3

Query: 6   SLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 185
           + E+ V +++P+           FT  +++ MA  +ERP+IFALSNPT+ AECTAE+ Y 
Sbjct: 291 TFEDAVNILRPSAIIGVAGAGRLFTPGVIKAMADINERPVIFALSNPTAMAECTAEEAYT 350

Query: 186 VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA 365
           +TEGR +FASGSPF+ V L DG+ F PGQGNN Y+FPGVAL VI    RHI D +FL  A
Sbjct: 351 LTEGRCLFASGSPFEPVKLSDGQLFTPGQGNNVYIFPGVALAVILCNTRHISDHVFLEAA 410

Query: 366 EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRS 545
           + +A +++++ L+QGRLYPPL+ I++VS+ IAIKV +Y Y + +A  YPEP+DK  ++R 
Sbjct: 411 KALANQLTDKELAQGRLYPPLADIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYIRE 470

Query: 546 LVYTPDYDSFTLDSYTWPKEAMN 614
            ++  +YDS   D Y WP+ A++
Sbjct: 471 RIWRSEYDSLLPDVYDWPESALS 493


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 96,868,866
Number of Sequences: 33732
Number of extensions: 2701654
Number of successful extensions: 8829
Number of sequences better than 1.0e-05: 9
Number of HSP's better than  0.0 without gapping: 6653
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8815
length of database: 19,266,565
effective HSP length: 111
effective length of database: 15,522,313
effective search space used: 10213681954
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TCH01_0075_F01
         (2310 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001014811.1| malic enzyme 3, NADP(+)-dependent, mitochond...   389   e-108
Alignment   gi|NP_006671.2| malic enzyme 3, NADP(+)-dependent, mitochondria...   389   e-108
Alignment   gi|NP_002386.1| cytosolic malic enzyme 1 [Homo sapiens]              268   2e-71
Alignment   gi|NP_002387.1| malic enzyme 2, NAD(+)-dependent, mitochondrial...   219   8e-57

>ref|NP_001014811.1| malic enzyme 3, NADP(+)-dependent, mitochondrial [Homo sapiens]
          Length = 604

 Score =  389 bits (1000), Expect = e-108
 Identities = 194/208 (93%), Positives = 196/208 (94%)
 Frame = +3

Query: 3    SSLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCY 182
            +SLEEVVRLVKPT           FTEQILRDMASFHERPIIFALSNPTSKAECTAEKCY
Sbjct: 397  NSLEEVVRLVKPTAIIGVAAIAGAFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCY 456

Query: 183  RVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLT 362
            RVTEGRGIFASGSPFKSVTLEDG+TFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLT
Sbjct: 457  RVTEGRGIFASGSPFKSVTLEDGKTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLT 516

Query: 363  AEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVR 542
            AEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVR
Sbjct: 517  AEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVR 576

Query: 543  SLVYTPDYDSFTLDSYTWPKEAMNVQNV 626
            SLVYTPDYDSFTLDSYTWPKEAMNVQ V
Sbjct: 577  SLVYTPDYDSFTLDSYTWPKEAMNVQTV 604


>ref|NP_006671.2| malic enzyme 3, NADP(+)-dependent, mitochondrial [Homo sapiens]
          Length = 604

 Score =  389 bits (1000), Expect = e-108
 Identities = 194/208 (93%), Positives = 196/208 (94%)
 Frame = +3

Query: 3    SSLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCY 182
            +SLEEVVRLVKPT           FTEQILRDMASFHERPIIFALSNPTSKAECTAEKCY
Sbjct: 397  NSLEEVVRLVKPTAIIGVAAIAGAFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCY 456

Query: 183  RVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLT 362
            RVTEGRGIFASGSPFKSVTLEDG+TFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLT
Sbjct: 457  RVTEGRGIFASGSPFKSVTLEDGKTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLT 516

Query: 363  AEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVR 542
            AEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVR
Sbjct: 517  AEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVR 576

Query: 543  SLVYTPDYDSFTLDSYTWPKEAMNVQNV 626
            SLVYTPDYDSFTLDSYTWPKEAMNVQ V
Sbjct: 577  SLVYTPDYDSFTLDSYTWPKEAMNVQTV 604


>ref|NP_002386.1| cytosolic malic enzyme 1 [Homo sapiens]
          Length = 572

 Score =  268 bits (684), Expect = 2e-71
 Identities = 127/205 (61%), Positives = 162/205 (79%)
 Frame = +3

Query: 6   SLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 185
           +LE +V+ +KPT           F+EQIL+DMA+F+ERPIIFALSNPTSKAEC+AE+CY+
Sbjct: 363 NLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYK 422

Query: 186 VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA 365
           +T+GR IFASGSPF  VTL +G+T  PGQGNN+YVFPGVALGV+A G+R I D IFL TA
Sbjct: 423 ITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTA 482

Query: 366 EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRS 545
           E IAQ+VS++HL +GRLYPPL+TIRDVSL+IA K++  AY+   A+ YPEP++KEAFVRS
Sbjct: 483 EVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRS 542

Query: 546 LVYTPDYDSFTLDSYTWPKEAMNVQ 620
            +Y+ DYD    D Y+WP+E   +Q
Sbjct: 543 QMYSTDYDQILPDCYSWPEEVQKIQ 567


>ref|NP_002387.1| malic enzyme 2, NAD(+)-dependent, mitochondrial [Homo sapiens]
          Length = 584

 Score =  219 bits (558), Expect = 8e-57
 Identities = 102/201 (50%), Positives = 139/201 (69%)
 Frame = +3

Query: 6   SLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 185
           + E+ V ++KP+           FT  ++R MAS +ERP+IFALSNPT++AECTAE+ Y 
Sbjct: 376 TFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYT 435

Query: 186 VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA 365
           +TEGR +FASGSPF  V L DGR F PGQGNN Y+FPGVAL VI    RHI D +FL  A
Sbjct: 436 LTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAA 495

Query: 366 EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRS 545
           + +  +++++ L+QGRLYPPL+ I++VS+ IAIKV +Y Y + +A  YPEP+DK  +V+ 
Sbjct: 496 KALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKE 555

Query: 546 LVYTPDYDSFTLDSYTWPKEA 608
             +  +YDS   D Y WP+ A
Sbjct: 556 RTWRSEYDSLLPDVYEWPESA 576


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 93,850,010
Number of Sequences: 39411
Number of extensions: 2711803
Number of successful extensions: 9482
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 6967
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9469
length of database: 17,774,539
effective HSP length: 110
effective length of database: 13,439,329
effective search space used: 8856517811
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TCH01_0075_F01
         (2310 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,197,583
Number of Sequences: 1040
Number of extensions: 59115
Number of successful extensions: 150
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 124
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 150
length of database: 434,620
effective HSP length: 84
effective length of database: 347,260
effective search space used: 237873100
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TCH01_0075_F01
         (2310 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_852072.1| malic enzyme 3, NADP(+)-dependent, mitochondria...   380   e-105
Alignment   gi|XP_001004679.1| PREDICTED: similar to NADP-dependent malic e...   278   2e-74
Alignment   gi|XP_001004682.1| PREDICTED: similar to NADP-dependent malic e...   273   4e-73
Alignment   gi|XP_001004683.1| PREDICTED: similar to NADP-dependent malic e...   273   4e-73
Alignment   gi|XP_001004685.1| PREDICTED: similar to NADP-dependent malic e...   273   4e-73
Alignment   gi|NP_032641.1| malic enzyme, supernatant [Mus musculus]             266   9e-71
Alignment   gi|NP_663469.1| malic enzyme 2, NAD(+)-dependent, mitochondrial...   209   1e-53
Alignment   gi|XP_001004303.1| PREDICTED: similar to NADP-dependent malic e...    95   4e-19

>ref|NP_852072.1| malic enzyme 3, NADP(+)-dependent, mitochondrial [Mus musculus]
          Length = 604

 Score =  380 bits (976), Expect = e-105
 Identities = 186/208 (89%), Positives = 195/208 (93%)
 Frame = +3

Query: 3    SSLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCY 182
            +SLEEVVRLVKPT           FTEQILRDMASFHERPI+FALSNPTSKAECTAEKCY
Sbjct: 397  NSLEEVVRLVKPTAIIGVAAIAGAFTEQILRDMASFHERPIVFALSNPTSKAECTAEKCY 456

Query: 183  RVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLT 362
            RVTEGRGIFASGSPFKSVTLEDGRTF PGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLT
Sbjct: 457  RVTEGRGIFASGSPFKSVTLEDGRTFTPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLT 516

Query: 363  AEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVR 542
            AEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIA+KVLDYAYKHNLASYYPEPKDKEAFV+
Sbjct: 517  AEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAVKVLDYAYKHNLASYYPEPKDKEAFVK 576

Query: 543  SLVYTPDYDSFTLDSYTWPKEAMNVQNV 626
            SL+YTPDYDSF+LD+Y+WPKEAM+VQ V
Sbjct: 577  SLIYTPDYDSFSLDTYSWPKEAMSVQKV 604


>ref|XP_001004679.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 1 [Mus musculus]
          Length = 554

 Score =  278 bits (711), Expect = 2e-74
 Identities = 131/206 (63%), Positives = 163/206 (79%)
 Frame = +3

Query: 3   SSLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCY 182
           S+LE +V+ +KPT           FTEQIL+DMA+F+ERPIIFALSNPTSKAEC+AE+CY
Sbjct: 344 SNLEAIVQKIKPTALIGVAAIGGAFTEQILKDMAAFNERPIIFALSNPTSKAECSAEQCY 403

Query: 183 RVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLT 362
           +VT+GR IFASGSPF  VTL DGRT  PGQGNN+YVFPGVALGV+A G+RHI D++FL T
Sbjct: 404 KVTKGRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFLTT 463

Query: 363 AEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVR 542
           AE I+Q+VS++HL +GRLYPPL+TIRDVSL+IA+KV  YAYK  +A+ YPEP++KE FV 
Sbjct: 464 AEVISQQVSDKHLQEGRLYPPLNTIRDVSLKIAVKVRQYAYKEKMATVYPEPQNKEEFVS 523

Query: 543 SLVYTPDYDSFTLDSYTWPKEAMNVQ 620
           S +Y+ +YD    D Y WP E   +Q
Sbjct: 524 SQMYSTNYDQILPDCYPWPAEVQKIQ 549


>ref|XP_001004682.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 2 [Mus musculus]
          Length = 258

 Score =  273 bits (699), Expect = 4e-73
 Identities = 128/205 (62%), Positives = 162/205 (79%)
 Frame = +3

Query: 6   SLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 185
           +LE +V+ +KPT           FTEQIL+DMA+F+ERPIIFALSNPTSKAEC+AE+CY+
Sbjct: 49  NLEAIVQKIKPTALIGVAAIGGAFTEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYK 108

Query: 186 VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA 365
           VT+GR IFASGSPF  VTL DGRT  PGQGNN+YVFPGVALGV+A G+RHI D++FL TA
Sbjct: 109 VTKGRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFLTTA 168

Query: 366 EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRS 545
           E I+Q+VS++HL +GRLYPPL+TIRDVSL+IA+K++  AYK  +A+ YPEP++KE FV S
Sbjct: 169 EVISQQVSDKHLQEGRLYPPLNTIRDVSLKIAVKIVQDAYKEKMATVYPEPQNKEEFVSS 228

Query: 546 LVYTPDYDSFTLDSYTWPKEAMNVQ 620
            +Y+ +YD    D Y WP E   +Q
Sbjct: 229 QMYSTNYDQILPDCYPWPAEVQKIQ 253


>ref|XP_001004683.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 3 [Mus musculus]
          Length = 406

 Score =  273 bits (699), Expect = 4e-73
 Identities = 128/205 (62%), Positives = 162/205 (79%)
 Frame = +3

Query: 6   SLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 185
           +LE +V+ +KPT           FTEQIL+DMA+F+ERPIIFALSNPTSKAEC+AE+CY+
Sbjct: 197 NLEAIVQKIKPTALIGVAAIGGAFTEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYK 256

Query: 186 VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA 365
           VT+GR IFASGSPF  VTL DGRT  PGQGNN+YVFPGVALGV+A G+RHI D++FL TA
Sbjct: 257 VTKGRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFLTTA 316

Query: 366 EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRS 545
           E I+Q+VS++HL +GRLYPPL+TIRDVSL+IA+K++  AYK  +A+ YPEP++KE FV S
Sbjct: 317 EVISQQVSDKHLQEGRLYPPLNTIRDVSLKIAVKIVQDAYKEKMATVYPEPQNKEEFVSS 376

Query: 546 LVYTPDYDSFTLDSYTWPKEAMNVQ 620
            +Y+ +YD    D Y WP E   +Q
Sbjct: 377 QMYSTNYDQILPDCYPWPAEVQKIQ 401


>ref|XP_001004685.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) isoform 4 [Mus musculus]
          Length = 552

 Score =  273 bits (699), Expect = 4e-73
 Identities = 128/205 (62%), Positives = 162/205 (79%)
 Frame = +3

Query: 6   SLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 185
           +LE +V+ +KPT           FTEQIL+DMA+F+ERPIIFALSNPTSKAEC+AE+CY+
Sbjct: 343 NLEAIVQKIKPTALIGVAAIGGAFTEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYK 402

Query: 186 VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA 365
           VT+GR IFASGSPF  VTL DGRT  PGQGNN+YVFPGVALGV+A G+RHI D++FL TA
Sbjct: 403 VTKGRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFLTTA 462

Query: 366 EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRS 545
           E I+Q+VS++HL +GRLYPPL+TIRDVSL+IA+K++  AYK  +A+ YPEP++KE FV S
Sbjct: 463 EVISQQVSDKHLQEGRLYPPLNTIRDVSLKIAVKIVQDAYKEKMATVYPEPQNKEEFVSS 522

Query: 546 LVYTPDYDSFTLDSYTWPKEAMNVQ 620
            +Y+ +YD    D Y WP E   +Q
Sbjct: 523 QMYSTNYDQILPDCYPWPAEVQKIQ 547


>ref|NP_032641.1| malic enzyme, supernatant [Mus musculus]
          Length = 572

 Score =  266 bits (679), Expect = 9e-71
 Identities = 124/205 (60%), Positives = 160/205 (78%)
 Frame = +3

Query: 6   SLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYR 185
           +LE +V+ +KPT           FTEQIL+DMA+F+ERPIIFALS+PTSKAEC+A++CY+
Sbjct: 363 NLEAIVQKIKPTALIGVAAIGGAFTEQILKDMAAFNERPIIFALSSPTSKAECSADECYK 422

Query: 186 VTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTA 365
           VT+GR IFASGSPF  VTL DGRT  PGQGNN+YVFPGVALGV+A G+RHI D++FL T 
Sbjct: 423 VTKGRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFLTTR 482

Query: 366 EQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRS 545
           E I+Q+VS++HL +GRLYPPL+TIR VSL+IA+K++  AYK  +A+ YPEP++KE FV S
Sbjct: 483 EVISQQVSDKHLQEGRLYPPLNTIRGVSLKIAVKIVQDAYKEKMATVYPEPQNKEEFVSS 542

Query: 546 LVYTPDYDSFTLDSYTWPKEAMNVQ 620
            +Y+ +YD    D Y WP E   +Q
Sbjct: 543 QMYSTNYDQILPDCYPWPAEVQKIQ 567


>ref|NP_663469.1| malic enzyme 2, NAD(+)-dependent, mitochondrial [Mus musculus]
          Length = 589

 Score =  209 bits (532), Expect = 1e-53
 Identities = 100/203 (49%), Positives = 139/203 (68%)
 Frame = +3

Query: 3   SSLEEVVRLVKPTXXXXXXXXXXXFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCY 182
           ++ E+ V  +KP+           FT  +++ MAS +ERPIIFALSNPT++AECTAE  Y
Sbjct: 375 ATFEDAVNKLKPSVIIGVAGAGPLFTHGVIKAMASINERPIIFALSNPTAQAECTAEDAY 434

Query: 183 RVTEGRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLT 362
            +TEGR +FASGSPF+ V L+DGR F PGQGNNAY+FPGVAL VI    RHI D +FL  
Sbjct: 435 TLTEGRCLFASGSPFEPVKLQDGRVFTPGQGNNAYIFPGVALAVILCEARHISDTVFLEA 494

Query: 363 AEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVR 542
           A+ +  ++++  L+QGRLYP L+ I++VS  IAIK+ +Y Y + +A  YPEP+DK  +VR
Sbjct: 495 AKALTTQLTDAELAQGRLYPSLANIQEVSANIAIKLAEYLYANKMAFRYPEPEDKARYVR 554

Query: 543 SLVYTPDYDSFTLDSYTWPKEAM 611
             ++  +Y S   D Y WP+ ++
Sbjct: 555 ERIWRSNYVSLLPDVYDWPESSL 577


>ref|XP_001004303.1| PREDICTED: similar to NADP-dependent malic enzyme (NADP-ME) (Malic
           enzyme 1) [Mus musculus]
          Length = 66

 Score = 94.7 bits (234), Expect = 4e-19
 Identities = 44/58 (75%), Positives = 49/58 (84%)
 Frame = +3

Query: 195 GRGIFASGSPFKSVTLEDGRTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTAE 368
           GR IFASGSPF  VTL DGRT  PGQGNN+YVFPGVALGV+A G+RHI D++FL TAE
Sbjct: 7   GRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFLTTAE 64


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 110,904,353
Number of Sequences: 45328
Number of extensions: 3082460
Number of successful extensions: 9946
Number of sequences better than 1.0e-05: 8
Number of HSP's better than  0.0 without gapping: 7557
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9934
length of database: 21,768,885
effective HSP length: 111
effective length of database: 16,737,477
effective search space used: 11013259866
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)