Animal-Genome cDNA THY01_0022_H06


Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= THY01_0022_H06
         (1252 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001030273.1| thioredoxin-like [Bos taurus]                     591   e-169
Alignment   gi|XP_873370.1| PREDICTED: similar to Thioredoxin-like protein ...   233   2e-61
Alignment   gi|XP_582303.1| PREDICTED: similar to CG14407-PA [Bos taurus]        100   2e-21
Alignment   gi|NP_776393.1| thioredoxin [Bos taurus]                              52   8e-07
Alignment   gi|XP_586040.2| PREDICTED: similar to Thioredoxin-like protein ...    49   6e-06

>ref|NP_001030273.1| thioredoxin-like [Bos taurus]
          Length = 334

 Score =  591 bits (1524), Expect = e-169
 Identities = 295/315 (93%), Positives = 298/315 (94%)
 Frame = +3

Query: 90   QFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY 269
            QFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEH QVSFVKLEAEAVPEVSEKY
Sbjct: 20   QFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHQQVSFVKLEAEAVPEVSEKY 79

Query: 270  GISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKL 449
             ISSVPTFLFFKNSQ IDRLDGAHAPELTKKVQRHA          EH KEDLSLRLKKL
Sbjct: 80   EISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFSPSGSEHPKEDLSLRLKKL 139

Query: 450  THAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFDIFSDEEVRQGLKTYSNWPTY 629
            THAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFDIFSDEEVRQGLKTYS+WPTY
Sbjct: 140  THAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFDIFSDEEVRQGLKTYSSWPTY 199

Query: 630  PQPYVSGELIGGLDIIKELEASKELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAK 809
            PQ YVSGELIGGLDIIKELEASKELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAK
Sbjct: 200  PQLYVSGELIGGLDIIKELEASKELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAK 259

Query: 810  CGFSRQILEILNSTGVDYETFDILEDEEVRQGLKTYSNWPTYPQLYVKGELVGGLDIVKG 989
            CGFSRQILEILNSTG++YETFDILEDEEVRQGLK YSNWPTYPQLYVKGELVGGLDIVK 
Sbjct: 260  CGFSRQILEILNSTGIEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKE 319

Query: 990  LKENGELLPILKGEN 1034
            LKENGELLPILKGEN
Sbjct: 320  LKENGELLPILKGEN 334


>ref|XP_873370.1| PREDICTED: similar to Thioredoxin-like protein 2 (PKC-interacting
            cousin of thioredoxin) (PKC-theta-interacting protein)
            (PKCq-interacting protein) (HUSSY-22) [Bos taurus]
          Length = 164

 Score =  233 bits (594), Expect = 2e-61
 Identities = 134/231 (58%), Positives = 140/231 (60%)
 Frame = +3

Query: 342  APELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQ 521
            APEL+KKVQ+HA          EHLKEDL+  LKKL  AAPC+LFMKGTPQEPRCGF+  
Sbjct: 2    APELSKKVQQHASGGSFSPSGSEHLKEDLNQPLKKLFLAAPCILFMKGTPQEPRCGFN-- 59

Query: 522  MVEILNKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQPYVSGELIGGLDIIKELEASKE 701
                                 EVRQ LKTYSNWPTYPQ YVSGELIGGLDIIKELEASKE
Sbjct: 60   ---------------------EVRQALKTYSNWPTYPQLYVSGELIGGLDIIKELEASKE 98

Query: 702  LDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSRQILEILNSTGVDYETFDIL 881
            LD ICPKAPKLEERLK                                            
Sbjct: 99   LDMICPKAPKLEERLK-------------------------------------------- 114

Query: 882  EDEEVRQGLKTYSNWPTYPQLYVKGELVGGLDIVKGLKENGELLPILKGEN 1034
             DEEV+QGLK YSNW TYPQL VKGELV GLDIVK  KENGELLPILKGEN
Sbjct: 115  -DEEVQQGLKAYSNWLTYPQLNVKGELVRGLDIVKERKENGELLPILKGEN 164


>ref|XP_582303.1| PREDICTED: similar to CG14407-PA [Bos taurus]
          Length = 158

 Score =  100 bits (250), Expect = 2e-21
 Identities = 45/97 (46%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = +3

Query: 738  ERLKVLTNKASVMLFMKGNKQEAKCGFSRQILEILNSTGV-DYETFDILEDEEVRQGLKT 914
            E L  L  K  V++F+KG  ++ +CGFS  +++IL   GV DY  +++L+D ++RQG+K 
Sbjct: 44   EHLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIKD 103

Query: 915  YSNWPTYPQLYVKGELVGGLDIVKGLKENGELLPILK 1025
            YSNWPT PQ+Y+ GE VGG DI+  + +NG+L+  LK
Sbjct: 104  YSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELK 140



 Score = 91.7 bits (226), Expect = 1e-18
 Identities = 38/93 (40%), Positives = 65/93 (69%), Gaps = 1/93 (1%)
 Frame = +3

Query: 429 SLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQ-FSSFDIFSDEEVRQGLK 605
           S  L  L      ++F+KGTP++P+CGFS  +V+IL  H ++ ++++++  D ++RQG+K
Sbjct: 43  SEHLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPQLRQGIK 102

Query: 606 TYSNWPTYPQPYVSGELIGGLDIIKELEASKEL 704
            YSNWPT PQ Y++GE +GG DI+ ++  + +L
Sbjct: 103 DYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDL 135


>ref|NP_776393.1| thioredoxin [Bos taurus]
          Length = 105

 Score = 52.4 bits (124), Expect = 8e-07
 Identities = 24/87 (27%), Positives = 45/87 (51%)
 Frame = +3

Query: 93  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 272
           F+E L    + L+VV F A W   C  +      L++++  V F++++ +   +V+ +  
Sbjct: 11  FQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVDDCQDVAAECE 70

Query: 273 ISSVPTFLFFKNSQSIDRLDGAHAPEL 353
           +  +PTF FFK  Q +    GA+  +L
Sbjct: 71  VKCMPTFQFFKKGQKVGEFSGANKEKL 97


>ref|XP_586040.2| PREDICTED: similar to Thioredoxin-like protein 1 (32 kDa
           thioredoxin-related protein) [Bos taurus]
          Length = 467

 Score = 49.3 bits (116), Expect = 6e-06
 Identities = 21/70 (30%), Positives = 40/70 (57%)
 Frame = +3

Query: 165 CAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYGISSVPTFLFFKNSQSIDRLDGAHA 344
           C ++    + ++ ++PQ  F++++       +    IS+ PTFLFF+N   ID+  GA A
Sbjct: 215 CLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADA 274

Query: 345 PELTKKVQRH 374
             L +K+++H
Sbjct: 275 VGLEEKIKQH 284


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 39,881,060
Number of Sequences: 33508
Number of extensions: 1012186
Number of successful extensions: 3333
Number of sequences better than 1.0e-05: 5
Number of HSP's better than  0.0 without gapping: 2886
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3314
length of database: 16,112,626
effective HSP length: 104
effective length of database: 12,627,794
effective search space used: 3939871728
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= THY01_0022_H06
         (1252 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_535061.2| PREDICTED: similar to Thioredoxin-like 2 protei...   585   e-167
Alignment   gi|XP_532029.2| PREDICTED: similar to Thioredoxin (ATL-derived ...    52   1e-06
Alignment   gi|XP_541090.2| PREDICTED: similar to Thioredoxin-like protein ...    49   8e-06

>ref|XP_535061.2| PREDICTED: similar to Thioredoxin-like 2 protein (PKC-interacting
            cousin of thioredoxin) (PKCq-interacting protein)
            (PKC-theta-interacting protein) [Canis familiaris]
          Length = 333

 Score =  585 bits (1507), Expect = e-167
 Identities = 290/315 (92%), Positives = 296/315 (93%)
 Frame = +3

Query: 90   QFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY 269
            QFEELLRLRAKSL+VVHFWAPWAPQC QMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY
Sbjct: 19   QFEELLRLRAKSLVVVHFWAPWAPQCVQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY 78

Query: 270  GISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKL 449
             ISSVPTFL FKNSQ IDRLDGAHAPELTKKVQRHA          EH KEDL +RLKKL
Sbjct: 79   EISSVPTFLLFKNSQKIDRLDGAHAPELTKKVQRHASSGSFPPSTNEHPKEDLHVRLKKL 138

Query: 450  THAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFDIFSDEEVRQGLKTYSNWPTY 629
            THAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFDIFSDEEVRQGLKTYSNWPTY
Sbjct: 139  THAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFDIFSDEEVRQGLKTYSNWPTY 198

Query: 630  PQPYVSGELIGGLDIIKELEASKELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAK 809
            PQ YVSGELIGGLDIIKELEAS ELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAK
Sbjct: 199  PQLYVSGELIGGLDIIKELEASDELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAK 258

Query: 810  CGFSRQILEILNSTGVDYETFDILEDEEVRQGLKTYSNWPTYPQLYVKGELVGGLDIVKG 989
            CGFS+QILEILNSTGV+YETFDILEDEEVRQGLKTYSNWPTYPQLYVKGELVGGLDIVK 
Sbjct: 259  CGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTYSNWPTYPQLYVKGELVGGLDIVKE 318

Query: 990  LKENGELLPILKGEN 1034
            LK+NGELLP+LKGEN
Sbjct: 319  LKDNGELLPVLKGEN 333


>ref|XP_532029.2| PREDICTED: similar to Thioredoxin (ATL-derived factor) (ADF)
           (Surface associated sulphydryl protein) (SASP) [Canis
           familiaris]
          Length = 219

 Score = 52.0 bits (123), Expect = 1e-06
 Identities = 24/87 (27%), Positives = 44/87 (50%)
 Frame = +3

Query: 93  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 272
           F+E L      L+VV F A W   C  +      L++++  V F++++ +   +V+ +  
Sbjct: 125 FQEALNSAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVDDCQDVASECE 184

Query: 273 ISSVPTFLFFKNSQSIDRLDGAHAPEL 353
           +  +PTF FFK  Q +    GA+  +L
Sbjct: 185 VKCMPTFQFFKKGQKVGEFSGANKEKL 211


>ref|XP_541090.2| PREDICTED: similar to Thioredoxin-like protein 1 (32 kDa
           thioredoxin-related protein) [Canis familiaris]
          Length = 267

 Score = 49.3 bits (116), Expect = 8e-06
 Identities = 21/70 (30%), Positives = 40/70 (57%)
 Frame = +3

Query: 165 CAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYGISSVPTFLFFKNSQSIDRLDGAHA 344
           C ++    + ++ ++PQ  F++++       +    IS+ PTFLFF+N   ID+  GA A
Sbjct: 12  CLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADA 71

Query: 345 PELTKKVQRH 374
             L +K+++H
Sbjct: 72  VGLEEKIKQH 81


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 46,922,617
Number of Sequences: 33732
Number of extensions: 1195423
Number of successful extensions: 3791
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 3298
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3779
length of database: 19,266,565
effective HSP length: 105
effective length of database: 15,724,705
effective search space used: 4890383255
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= THY01_0022_H06
         (1252 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_006532.2| thioredoxin-like [Homo sapiens]                      580   e-165
Alignment   gi|NP_057501.2| glutaredoxin 5 [Homo sapiens]                        102   7e-22
Alignment   gi|XP_947255.1| PREDICTED: similar to Thioredoxin domain-contai...    53   6e-07
Alignment   gi|XP_950856.1| PREDICTED: similar to thioredoxin domain-contai...    53   6e-07
Alignment   gi|XP_950855.1| PREDICTED: similar to thioredoxin domain-contai...    53   6e-07
Alignment   gi|NP_115619.4| thioredoxin domain-containing 2 [Homo sapiens]        53   6e-07
Alignment   gi|NP_004777.1| thioredoxin-like 1 [Homo sapiens]                     52   1e-06
Alignment   gi|NP_003320.2| thioredoxin [Homo sapiens]                            52   1e-06

>ref|NP_006532.2| thioredoxin-like [Homo sapiens]
          Length = 335

 Score =  580 bits (1494), Expect = e-165
 Identities = 288/315 (91%), Positives = 297/315 (94%)
 Frame = +3

Query: 90   QFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY 269
            QFEELLRL+AKSLLVVHFWAPWAPQCAQMN+VMAELAKE PQVSFVKLEAE VPEVSEKY
Sbjct: 21   QFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKY 80

Query: 270  GISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKL 449
             ISSVPTFLFFKNSQ IDRLDGAHAPELTKKVQRHA          EHLKEDL+LRLKKL
Sbjct: 81   EISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKL 140

Query: 450  THAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFDIFSDEEVRQGLKTYSNWPTY 629
            THAAPCMLFMKGTPQEPRCGFSKQMVEIL+KHNIQFSSFDIFSDEEVRQGLK YS+WPTY
Sbjct: 141  THAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTY 200

Query: 630  PQPYVSGELIGGLDIIKELEASKELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAK 809
            PQ YVSGELIGGLDIIKELEAS+ELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAK
Sbjct: 201  PQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAK 260

Query: 810  CGFSRQILEILNSTGVDYETFDILEDEEVRQGLKTYSNWPTYPQLYVKGELVGGLDIVKG 989
            CGFS+QILEILNSTGV+YETFDILEDEEVRQGLK YSNWPTYPQLYVKGELVGGLDIVK 
Sbjct: 261  CGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKE 320

Query: 990  LKENGELLPILKGEN 1034
            LKENGELLPIL+GEN
Sbjct: 321  LKENGELLPILRGEN 335


>ref|NP_057501.2| glutaredoxin 5 [Homo sapiens]
          Length = 157

 Score =  102 bits (254), Expect = 7e-22
 Identities = 46/97 (47%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = +3

Query: 738  ERLKVLTNKASVMLFMKGNKQEAKCGFSRQILEILNSTGV-DYETFDILEDEEVRQGLKT 914
            E+L  L  K  V++F+KG  ++ +CGFS  +++IL   GV DY  +++L+D E+RQG+K 
Sbjct: 43   EQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKD 102

Query: 915  YSNWPTYPQLYVKGELVGGLDIVKGLKENGELLPILK 1025
            YSNWPT PQ+Y+ GE VGG DI+  + +NG+L+  LK
Sbjct: 103  YSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELK 139



 Score = 92.8 bits (229), Expect = 5e-19
 Identities = 38/91 (41%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +3

Query: 435 RLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQ-FSSFDIFSDEEVRQGLKTY 611
           +L  L      ++F+KGTP++P+CGFS  +V+IL  H ++ ++++++  D E+RQG+K Y
Sbjct: 44  QLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDY 103

Query: 612 SNWPTYPQPYVSGELIGGLDIIKELEASKEL 704
           SNWPT PQ Y++GE +GG DI+ ++  + +L
Sbjct: 104 SNWPTIPQVYLNGEFVGGCDILLQMHQNGDL 134


>ref|XP_947255.1| PREDICTED: similar to Thioredoxin domain-containing protein 2
           (Spermatid-specific thioredoxin-1) (Sptrx-1) isoform 1
           [Homo sapiens]
          Length = 538

 Score = 52.8 bits (125), Expect = 6e-07
 Identities = 27/82 (32%), Positives = 42/82 (51%)
 Frame = +3

Query: 93  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 272
           FE  L+   + L+ V F A W   C  +      L+ +H  V F++++A+   EV  +  
Sbjct: 444 FEASLKEAGERLVAVDFSATWCGPCRTIRPFFHALSVKHEDVVFLEVDADNCEEVVRECA 503

Query: 273 ISSVPTFLFFKNSQSIDRLDGA 338
           I  VPTF F+K  + +D L GA
Sbjct: 504 IMCVPTFQFYKKEEKVDELCGA 525


>ref|XP_950856.1| PREDICTED: similar to thioredoxin domain-containing 2 isoform 3
           [Homo sapiens]
          Length = 471

 Score = 52.8 bits (125), Expect = 6e-07
 Identities = 27/82 (32%), Positives = 42/82 (51%)
 Frame = +3

Query: 93  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 272
           FE  L+   + L+ V F A W   C  +      L+ +H  V F++++A+   EV  +  
Sbjct: 377 FEASLKEAGERLVAVDFSATWCGPCRTIRPFFHALSVKHEDVVFLEVDADNCEEVVRECA 436

Query: 273 ISSVPTFLFFKNSQSIDRLDGA 338
           I  VPTF F+K  + +D L GA
Sbjct: 437 IMCVPTFQFYKKEEKVDELCGA 458


>ref|XP_950855.1| PREDICTED: similar to thioredoxin domain-containing 2 isoform 2
           [Homo sapiens]
          Length = 471

 Score = 52.8 bits (125), Expect = 6e-07
 Identities = 27/82 (32%), Positives = 42/82 (51%)
 Frame = +3

Query: 93  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 272
           FE  L+   + L+ V F A W   C  +      L+ +H  V F++++A+   EV  +  
Sbjct: 377 FEASLKEAGERLVAVDFSATWCGPCRTIRPFFHALSVKHEDVVFLEVDADNCEEVVRECA 436

Query: 273 ISSVPTFLFFKNSQSIDRLDGA 338
           I  VPTF F+K  + +D L GA
Sbjct: 437 IMCVPTFQFYKKEEKVDELCGA 458


>ref|NP_115619.4| thioredoxin domain-containing 2 [Homo sapiens]
          Length = 486

 Score = 52.8 bits (125), Expect = 6e-07
 Identities = 27/82 (32%), Positives = 42/82 (51%)
 Frame = +3

Query: 93  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 272
           FE  L+   + L+ V F A W   C  +      L+ +H  V F++++A+   EV  +  
Sbjct: 392 FEASLKEAGERLVAVDFSATWCGPCRTIRPFFHALSVKHEDVVFLEVDADNCEEVVRECA 451

Query: 273 ISSVPTFLFFKNSQSIDRLDGA 338
           I  VPTF F+K  + +D L GA
Sbjct: 452 IMCVPTFQFYKKEEKVDELCGA 473


>ref|NP_004777.1| thioredoxin-like 1 [Homo sapiens]
          Length = 289

 Score = 52.0 bits (123), Expect = 1e-06
 Identities = 27/94 (28%), Positives = 47/94 (50%)
 Frame = +3

Query: 93  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 272
           F+  L      L VV F       C ++    + ++ ++PQ  F++++       +    
Sbjct: 13  FQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNN 72

Query: 273 ISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRH 374
           IS+ PTFLFF+N   ID+  GA A  L +K+++H
Sbjct: 73  ISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQH 106


>ref|NP_003320.2| thioredoxin [Homo sapiens]
          Length = 105

 Score = 51.6 bits (122), Expect = 1e-06
 Identities = 24/87 (27%), Positives = 44/87 (50%)
 Frame = +3

Query: 93  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 272
           F+E L      L+VV F A W   C  +      L++++  V F++++ +   +V+ +  
Sbjct: 11  FQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECE 70

Query: 273 ISSVPTFLFFKNSQSIDRLDGAHAPEL 353
           +  +PTF FFK  Q +    GA+  +L
Sbjct: 71  VKCMPTFQFFKKGQKVGEFSGANKEKL 97


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 45,157,645
Number of Sequences: 39411
Number of extensions: 1179439
Number of successful extensions: 3846
Number of sequences better than 1.0e-05: 8
Number of HSP's better than  0.0 without gapping: 3220
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3833
length of database: 17,774,539
effective HSP length: 105
effective length of database: 13,636,384
effective search space used: 4240915424
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= THY01_0022_H06
         (1252 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_999478.1| thioredoxin [Sus scrofa]                              53   2e-08

>ref|NP_999478.1| thioredoxin [Sus scrofa]
          Length = 105

 Score = 52.8 bits (125), Expect = 2e-08
 Identities = 24/87 (27%), Positives = 45/87 (51%)
 Frame = +3

Query: 93  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 272
           F+E L    + L+VV F A W   C  +      L++++  V F++++ +   +V+ +  
Sbjct: 11  FQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVDDCQDVASECE 70

Query: 273 ISSVPTFLFFKNSQSIDRLDGAHAPEL 353
           +  +PTF FFK  Q +    GA+  +L
Sbjct: 71  VKCMPTFQFFKKGQKVGEFSGANKEKL 97


  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,069,044
Number of Sequences: 1040
Number of extensions: 26355
Number of successful extensions: 72
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 61
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 72
length of database: 434,620
effective HSP length: 79
effective length of database: 352,460
effective search space used: 118779020
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= THY01_0022_H06
         (1252 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_075629.2| thioredoxin-like 2 [Mus musculus]                    583   e-166
Alignment   gi|XP_995522.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   191   1e-48
Alignment   gi|XP_978406.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   191   1e-48
Alignment   gi|XP_978323.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   191   1e-48
Alignment   gi|NP_082695.1| glutaredoxin 5 [Mus musculus]                        102   8e-22
Alignment   gi|NP_705739.1| thioredoxin domain containing 2 (spermatozoa) [...    56   9e-08
Alignment   gi|NP_058072.2| thioredoxin-like 1 [Mus musculus]                     52   1e-06
Alignment   gi|NP_035790.1| thioredoxin 1 [Mus musculus]                          51   3e-06

>ref|NP_075629.2| thioredoxin-like 2 [Mus musculus]
          Length = 337

 Score =  583 bits (1502), Expect = e-166
 Identities = 287/315 (91%), Positives = 297/315 (94%)
 Frame = +3

Query: 90   QFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY 269
            QFEELLRL+ KSLLVVHFWAPWAPQC QMNDVMAELAKEHP VSFVKLEAEAVPEVSEKY
Sbjct: 23   QFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVSEKY 82

Query: 270  GISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKL 449
             ISSVPTFLFFKNSQ +DRLDGAHAPELTKKVQRH           EHLKEDLSLRLKKL
Sbjct: 83   EISSVPTFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGAFPPSTNEHLKEDLSLRLKKL 142

Query: 450  THAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQFSSFDIFSDEEVRQGLKTYSNWPTY 629
            THAAPCMLFMKGTPQEPRCGFSKQMVEIL+KHNIQFSSFDIFSDEEVRQGLKTYSNWPTY
Sbjct: 143  THAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKTYSNWPTY 202

Query: 630  PQPYVSGELIGGLDIIKELEASKELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAK 809
            PQ YVSGELIGGLDIIKELEAS+ELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAK
Sbjct: 203  PQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAK 262

Query: 810  CGFSRQILEILNSTGVDYETFDILEDEEVRQGLKTYSNWPTYPQLYVKGELVGGLDIVKG 989
            CGFS+QILEILNSTGV+YETFDILEDEEVRQGLKT+SNWPTYPQLYV+G+LVGGLDIVK 
Sbjct: 263  CGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTFSNWPTYPQLYVRGDLVGGLDIVKE 322

Query: 990  LKENGELLPILKGEN 1034
            LK+NGELLPILKGEN
Sbjct: 323  LKDNGELLPILKGEN 337


>ref|XP_995522.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  191 bits (485), Expect = 1e-48
 Identities = 113/205 (55%), Positives = 132/205 (64%)
 Frame = +1

Query: 418  KKTSAFA*RS*PTLPPACCS*REHPRSRAAVSASRWWKFLTNIISSLAVLISSQMKKFAK 597
            KKTSAFA +S  TLPPACCS REH ++RA VSASRWWK  TN I S A LISSQMKKF +
Sbjct: 160  KKTSAFAXKSXLTLPPACCSXREHLKNRAVVSASRWWKSFTNTIFSSAALISSQMKKFDR 219

Query: 598  ASKXXXXXXXXXXXMFLESS*EDLI*SRS*KHLKN*IQFAPKLPN*RKGSKY*QIKLL*C 777
             SK           MFLES  EDL   RS KH K+  +  PK P+ RKGSK   IKL  C
Sbjct: 220  GSKRTLIGPPILSSMFLESXXEDLTXLRSWKHQKSWTRSVPKHPSXRKGSKCXPIKLRXC 279

Query: 778  SL*RETNRKPSVVSADKSWKF*IVLVSTTRRSTYWRMRKSGRG*KPTPTGRRTLSCM*KG 957
            SL +ETNRK +V SA+K WK+ IVL    +   YW+M+K  R  K +  G+ TLSCM +G
Sbjct: 280  SLXKETNRKQNVDSANKFWKYXIVLGLNMKLLIYWKMKKCVRDXKRSQIGQPTLSCMXEG 339

Query: 958  SWSEAWILLRD*KKTVSCCLS*KEK 1032
               E WIL R+ K TV+CCL  KEK
Sbjct: 340  ILLEDWILSRNXKTTVNCCLYXKEK 364



 Score =  182 bits (461), Expect = 8e-46
 Identities = 91/125 (72%), Positives = 96/125 (76%)
 Frame = +3

Query: 90  QFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY 269
           QFEELLRL+ KSLLVVHFWAPWAPQC QMNDVMAELAKEHP VSFVKLEAEAVPEVSEKY
Sbjct: 51  QFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVSEKY 110

Query: 270 GISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKL 449
            ISSVP+FLFFKNSQ +DRLDGAHAPELTKKVQRH             LK+  +   K  
Sbjct: 111 EISSVPSFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGAFRLVLMNILKKTSAFAXKSX 170

Query: 450 THAAP 464
               P
Sbjct: 171 LTLPP 175


>ref|XP_978406.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  191 bits (485), Expect = 1e-48
 Identities = 113/205 (55%), Positives = 132/205 (64%)
 Frame = +1

Query: 418  KKTSAFA*RS*PTLPPACCS*REHPRSRAAVSASRWWKFLTNIISSLAVLISSQMKKFAK 597
            KKTSAFA +S  TLPPACCS REH ++RA VSASRWWK  TN I S A LISSQMKKF +
Sbjct: 160  KKTSAFAXKSXLTLPPACCSXREHLKNRAVVSASRWWKSFTNTIFSSAALISSQMKKFDR 219

Query: 598  ASKXXXXXXXXXXXMFLESS*EDLI*SRS*KHLKN*IQFAPKLPN*RKGSKY*QIKLL*C 777
             SK           MFLES  EDL   RS KH K+  +  PK P+ RKGSK   IKL  C
Sbjct: 220  GSKRTLIGPPILSSMFLESXXEDLTXLRSWKHQKSWTRSVPKHPSXRKGSKCXPIKLRXC 279

Query: 778  SL*RETNRKPSVVSADKSWKF*IVLVSTTRRSTYWRMRKSGRG*KPTPTGRRTLSCM*KG 957
            SL +ETNRK +V SA+K WK+ IVL    +   YW+M+K  R  K +  G+ TLSCM +G
Sbjct: 280  SLXKETNRKQNVDSANKFWKYXIVLGLNMKLLIYWKMKKCVRDXKRSQIGQPTLSCMXEG 339

Query: 958  SWSEAWILLRD*KKTVSCCLS*KEK 1032
               E WIL R+ K TV+CCL  KEK
Sbjct: 340  ILLEDWILSRNXKTTVNCCLYXKEK 364



 Score =  182 bits (461), Expect = 8e-46
 Identities = 91/125 (72%), Positives = 96/125 (76%)
 Frame = +3

Query: 90  QFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY 269
           QFEELLRL+ KSLLVVHFWAPWAPQC QMNDVMAELAKEHP VSFVKLEAEAVPEVSEKY
Sbjct: 51  QFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVSEKY 110

Query: 270 GISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKL 449
            ISSVP+FLFFKNSQ +DRLDGAHAPELTKKVQRH             LK+  +   K  
Sbjct: 111 EISSVPSFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGAFRLVLMNILKKTSAFAXKSX 170

Query: 450 THAAP 464
               P
Sbjct: 171 LTLPP 175


>ref|XP_978323.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  191 bits (485), Expect = 1e-48
 Identities = 113/205 (55%), Positives = 132/205 (64%)
 Frame = +1

Query: 418  KKTSAFA*RS*PTLPPACCS*REHPRSRAAVSASRWWKFLTNIISSLAVLISSQMKKFAK 597
            KKTSAFA +S  TLPPACCS REH ++RA VSASRWWK  TN I S A LISSQMKKF +
Sbjct: 160  KKTSAFAXKSXLTLPPACCSXREHLKNRAVVSASRWWKSFTNTIFSSAALISSQMKKFDR 219

Query: 598  ASKXXXXXXXXXXXMFLESS*EDLI*SRS*KHLKN*IQFAPKLPN*RKGSKY*QIKLL*C 777
             SK           MFLES  EDL   RS KH K+  +  PK P+ RKGSK   IKL  C
Sbjct: 220  GSKRTLIGPPILSSMFLESXXEDLTXLRSWKHQKSWTRSVPKHPSXRKGSKCXPIKLRXC 279

Query: 778  SL*RETNRKPSVVSADKSWKF*IVLVSTTRRSTYWRMRKSGRG*KPTPTGRRTLSCM*KG 957
            SL +ETNRK +V SA+K WK+ IVL    +   YW+M+K  R  K +  G+ TLSCM +G
Sbjct: 280  SLXKETNRKQNVDSANKFWKYXIVLGLNMKLLIYWKMKKCVRDXKRSQIGQPTLSCMXEG 339

Query: 958  SWSEAWILLRD*KKTVSCCLS*KEK 1032
               E WIL R+ K TV+CCL  KEK
Sbjct: 340  ILLEDWILSRNXKTTVNCCLYXKEK 364



 Score =  182 bits (461), Expect = 8e-46
 Identities = 91/125 (72%), Positives = 96/125 (76%)
 Frame = +3

Query: 90  QFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY 269
           QFEELLRL+ KSLLVVHFWAPWAPQC QMNDVMAELAKEHP VSFVKLEAEAVPEVSEKY
Sbjct: 51  QFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVSEKY 110

Query: 270 GISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKL 449
            ISSVP+FLFFKNSQ +DRLDGAHAPELTKKVQRH             LK+  +   K  
Sbjct: 111 EISSVPSFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGAFRLVLMNILKKTSAFAXKSX 170

Query: 450 THAAP 464
               P
Sbjct: 171 LTLPP 175


>ref|NP_082695.1| glutaredoxin 5 [Mus musculus]
          Length = 152

 Score =  102 bits (254), Expect = 8e-22
 Identities = 46/97 (47%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = +3

Query: 738  ERLKVLTNKASVMLFMKGNKQEAKCGFSRQILEILNSTGV-DYETFDILEDEEVRQGLKT 914
            E+L  L  K  V++F+KG  ++ +CGFS  +++IL   GV DY  +++L+D E+RQG+K 
Sbjct: 39   EQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKD 98

Query: 915  YSNWPTYPQLYVKGELVGGLDIVKGLKENGELLPILK 1025
            YSNWPT PQ+Y+ GE VGG DI+  + +NG+L+  LK
Sbjct: 99   YSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELK 135



 Score = 92.8 bits (229), Expect = 7e-19
 Identities = 38/91 (41%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +3

Query: 435 RLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILNKHNIQ-FSSFDIFSDEEVRQGLKTY 611
           +L  L      ++F+KGTP++P+CGFS  +V+IL  H ++ ++++++  D E+RQG+K Y
Sbjct: 40  QLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDY 99

Query: 612 SNWPTYPQPYVSGELIGGLDIIKELEASKEL 704
           SNWPT PQ Y++GE +GG DI+ ++  + +L
Sbjct: 100 SNWPTIPQVYLNGEFVGGCDILLQMHQNGDL 130


>ref|NP_705739.1| thioredoxin domain containing 2 (spermatozoa) [Mus musculus]
          Length = 462

 Score = 55.8 bits (133), Expect = 9e-08
 Identities = 26/92 (28%), Positives = 48/92 (52%)
 Frame = +3

Query: 90  QFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY 269
           +FEE+L+   + L+ V F A W   C  M  +   L+ +H  V F++++ E   ++ +  
Sbjct: 367 EFEEVLKDAGEKLVAVDFSAAWCGPCRMMKPLFHSLSLKHEDVIFLEVDTEDCEQLVQDC 426

Query: 270 GISSVPTFLFFKNSQSIDRLDGAHAPELTKKV 365
            I  +PTF F+KN + +    GA   +L + +
Sbjct: 427 EIFHLPTFQFYKNEEKVGEFSGALVGKLERSI 458


>ref|NP_058072.2| thioredoxin-like 1 [Mus musculus]
          Length = 289

 Score = 52.0 bits (123), Expect = 1e-06
 Identities = 27/94 (28%), Positives = 47/94 (50%)
 Frame = +3

Query: 93  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 272
           F+  L      L VV F       C ++    + ++ ++PQ  F++++       +    
Sbjct: 13  FQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNN 72

Query: 273 ISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRH 374
           IS+ PTFLFF+N   ID+  GA A  L +K+++H
Sbjct: 73  ISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQH 106


>ref|NP_035790.1| thioredoxin 1 [Mus musculus]
          Length = 105

 Score = 50.8 bits (120), Expect = 3e-06
 Identities = 24/95 (25%), Positives = 44/95 (46%)
 Frame = +3

Query: 93  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 272
           F+E L      L+VV F A W   C  +      L  ++  V F++++ +   +V+    
Sbjct: 11  FQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYSNVVFLEVDVDDCQDVAADCE 70

Query: 273 ISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHA 377
           +  +PTF F+K  Q +    GA+  +L   +  +A
Sbjct: 71  VKCMPTFQFYKKGQKVGEFSGANKEKLEASITEYA 105


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 53,565,267
Number of Sequences: 45328
Number of extensions: 1353888
Number of successful extensions: 4409
Number of sequences better than 1.0e-05: 8
Number of HSP's better than  0.0 without gapping: 3801
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4389
length of database: 21,768,885
effective HSP length: 106
effective length of database: 16,964,117
effective search space used: 5258876270
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)