Animal-Genome cDNA THY01_0114_B04


Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= THY01_0114_B04
         (1351 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_612082.2| PREDICTED: similar to LanC-like protein 1 (40 k...   422   0.0  
Alignment   gi|XP_611101.2| PREDICTED: similar to LanC-like protein 2 (Test...   186   4e-47
Alignment   gi|XP_614740.2| PREDICTED: similar to LanC-like protein 2 (Test...   182   4e-46
Alignment   gi|XP_597454.2| PREDICTED: similar to LanC lantibiotic syntheta...   166   9e-42

>ref|XP_612082.2| PREDICTED: similar to LanC-like protein 1 (40 kDa erythrocyte
            membrane protein) (p40) [Bos taurus]
          Length = 399

 Score =  422 bits (1085), Expect(2) = 0.0
 Identities = 192/207 (92%), Positives = 202/207 (97%)
 Frame = +1

Query: 619  LARKRNFTEKTPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKLQSLVKPSVDYVC 798
            LARKR FT KTPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKL +LVKPSVDYVC
Sbjct: 193  LARKRRFTGKTPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKLHNLVKPSVDYVC 252

Query: 799  QLKFPSGNYPPCVDDTRDLLVHWCHGSPGVIYMLIQAYKVFREERYLNDAYQCADVIWKY 978
            QLKFPSGNYPPCVDD+RDLL+HWCHG+PGVIYML QAYKVF+EERYLNDAYQCADVIW+Y
Sbjct: 253  QLKFPSGNYPPCVDDSRDLLIHWCHGAPGVIYMLTQAYKVFKEERYLNDAYQCADVIWQY 312

Query: 979  GLLKKGYGLCHGTAGNAYAFLTLFNLTQDMKYLYRACKFAEWCLDYGEHGCRTPDTPFSL 1158
            GLLKKGYGLCHGTAGNAYAFL+L++LTQD KYLYRACKFAEWCLDYGEHGCRTPDTPFSL
Sbjct: 313  GLLKKGYGLCHGTAGNAYAFLSLYSLTQDAKYLYRACKFAEWCLDYGEHGCRTPDTPFSL 372

Query: 1159 FEGMAGTIYFLADLLVPTKAKFPAFEL 1239
            FEGMAGTIYFLADLLVPTKA+FPAFEL
Sbjct: 373  FEGMAGTIYFLADLLVPTKARFPAFEL 399



 Score =  365 bits (936), Expect(2) = 0.0
 Identities = 177/194 (91%), Positives = 184/194 (94%)
 Frame = +3

Query: 39  MAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQQMERGLKSADPRDGT 218
           MAQRAFPNPYAD+NKSLAEGYFDSAGRLTPEFSQR+NNKIRELLQQMERGLKSADPRD T
Sbjct: 1   MAQRAFPNPYADYNKSLAEGYFDSAGRLTPEFSQRLNNKIRELLQQMERGLKSADPRDST 60

Query: 219 AYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSLNCLTKRSITFLCGDAGPLAVAAVV 398
            YTGWAGIAVLYLHLYDVFGDP YLQMAHGY KQSLN L+K SITFLCGD GPLAVAAVV
Sbjct: 61  VYTGWAGIAVLYLHLYDVFGDPNYLQMAHGYVKQSLNSLSKHSITFLCGDGGPLAVAAVV 120

Query: 399 HDKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRMGYIYALLFVNKNFGVEKIPRSHIQ 578
           H KMNNEKQAE+CITRLIHLNKIDPHAP+EMLYGRMGYI ALLFVNKNFG EKIP+SHIQ
Sbjct: 121 HHKMNNEKQAEECITRLIHLNKIDPHAPSEMLYGRMGYISALLFVNKNFGEEKIPQSHIQ 180

Query: 579 QICETVLTSGENLA 620
           QICETVLTSGE+LA
Sbjct: 181 QICETVLTSGEDLA 194


>ref|XP_611101.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific adriamycin
            sensitivity protein), partial [Bos taurus]
          Length = 149

 Score =  186 bits (472), Expect = 4e-47
 Identities = 78/108 (72%), Positives = 97/108 (89%)
 Frame = +1

Query: 916  VFREERYLNDAYQCADVIWKYGLLKKGYGLCHGTAGNAYAFLTLFNLTQDMKYLYRACKF 1095
            VF+EE+YL DA +C+DVIW+ GLL+KGYG+CHGTAGN Y+FL+L+++TQD KYLYRACKF
Sbjct: 30   VFKEEKYLKDAVECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHITQDKKYLYRACKF 89

Query: 1096 AEWCLDYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKAKFPAFEL 1239
            AEWCL+YG HGCR PD P+SLFEGMAGTI+FL+D+L P  ++FPAFEL
Sbjct: 90   AEWCLEYGAHGCRIPDRPYSLFEGMAGTIHFLSDILAPEASRFPAFEL 137


>ref|XP_614740.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific
           adriamycin sensitivity protein), partial [Bos taurus]
          Length = 331

 Score =  182 bits (463), Expect = 4e-46
 Identities = 95/224 (42%), Positives = 138/224 (61%), Gaps = 22/224 (9%)
 Frame = +3

Query: 39  MAQRAFPNPYADFNKSLAEGY------------------FDSAGRLTPEFSQRVNNKIRE 164
           M  RAFPNP+ D+  +                       F S G++   F++R+  KI++
Sbjct: 19  MEDRAFPNPFPDYEAAAERQAEEPPCSRTPLSPEELGLPFHSDGKIINNFTRRIQTKIKD 78

Query: 165 LLQQMERGLKSADPRDGTAYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSLNCLTKR 344
           LLQQME GLK+ADP D +AYTGW GIA+LYL LY V  D +YL  +  Y K++L  L  R
Sbjct: 79  LLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQSYLLRSLDYVKRTLRNLNGR 138

Query: 345 SITFLCGDAGPLAVAAVVHDKMNNEKQAEDCITRLIHLNKI----DPHAPNEMLYGRMGY 512
            +TFLCGDAGPLAV AVV+ K+ ++ ++++CIT+L+ L +     D   P+E+LYGR GY
Sbjct: 139 RVTFLCGDAGPLAVGAVVYHKLKSDCESQECITKLLQLQRTIVCRDSDLPDELLYGRAGY 198

Query: 513 IYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLAG*KKKLHR 644
           +YALL+VN   G   +  S I+++   ++ SG+ L+  +KK+ R
Sbjct: 199 LYALLYVNTEIGPGAVCESAIKEVVNAIIESGKALSKEEKKVER 242



 Score =  124 bits (310), Expect = 2e-28
 Identities = 52/99 (52%), Positives = 75/99 (75%)
 Frame = +1

Query: 619 LARKRNFTEKTPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKLQSLVKPSVDYVC 798
           L+++    E+ PL+Y+W+++ YVGAAHG+AGIYY LMQP+ +V    L  +VKPS+DY+ 
Sbjct: 233 LSKEEKKVERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMR 292

Query: 799 QLKFPSGNYPPCVDDTRDLLVHWCHGSPGVIYMLIQAYK 915
             +F SGNYP  + +  D LVHWCHG+PGVI++L+QA+K
Sbjct: 293 HKRFRSGNYPSSLSNETDRLVHWCHGAPGVIHVLMQAHK 331


>ref|XP_597454.2| PREDICTED: similar to LanC lantibiotic synthetase component C-like 3
            [Bos taurus]
          Length = 244

 Score =  166 bits (421), Expect(2) = 9e-42
 Identities = 85/200 (42%), Positives = 130/200 (65%), Gaps = 4/200 (2%)
 Frame = +1

Query: 652  PLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKLQSLVKPSVDYVCQLKFPSGNYPP 831
            PLMY +Y   Y+GAAHGL+ I   L+     +  +  Q LV  SVD++ + +  + N+PP
Sbjct: 45   PLMYSYYGTEYLGAAHGLSSILQMLLSYHEHLKPSD-QELVWQSVDFLMEQE-QNCNWPP 102

Query: 832  CVDDT---RDLLVHWCHGSPGVIYMLIQAYKVFREERYLNDAYQCADVIWKYGLLKKGYG 1002
             + +     + LVHWCHG+PG+ Y+  +AY V ++ +YL+   +C ++ W+ GLLKKG G
Sbjct: 103  ELGEAIERENELVHWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLKKGPG 162

Query: 1003 LCHGTAGNAYAFLTLFNLTQDMKYLYRACKFAEWCL-DYGEHGCRTPDTPFSLFEGMAGT 1179
            +CHG AG+AY FL L+ LT + KY+YRA +FAE+   +  + G R  ++ +SL+EG +GT
Sbjct: 163  ICHGVAGSAYVFLLLYRLTGNSKYIYRAQRFAEFLFTEEFKAGSRVLESIYSLYEGFSGT 222

Query: 1180 IYFLADLLVPTKAKFPAFEL 1239
            + FL DLL P +A+FP F +
Sbjct: 223  VCFLIDLLQPNQAEFPLFSV 242



 Score = 23.1 bits (48), Expect(2) = 9e-42
 Identities = 10/32 (31%), Positives = 19/32 (59%)
 Frame = +3

Query: 540 NFGVEKIPRSHIQQICETVLTSGENLAG*KKK 635
           +F  + +  + I+ IC+ +L SG+  A  K+K
Sbjct: 11  DFLTQVLTPAQIKSICQAILDSGKQYAMKKRK 42


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 44,269,003
Number of Sequences: 33508
Number of extensions: 1077592
Number of successful extensions: 2855
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 2619
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2847
length of database: 16,112,626
effective HSP length: 105
effective length of database: 12,594,286
effective search space used: 4332434384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= THY01_0114_B04
         (1351 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_536055.1| PREDICTED: similar to LanC-like protein 1 (40 k...   420   0.0  
Alignment   gi|XP_540359.2| PREDICTED: similar to LanC-like protein 2 (Test...   310   2e-84
Alignment   gi|XP_548943.2| PREDICTED: similar to LanC lantibiotic syntheta...   166   8e-50

>ref|XP_536055.1| PREDICTED: similar to LanC-like protein 1 (40 kDa erythrocyte
            membrane protein) (p40) [Canis familiaris]
          Length = 399

 Score =  420 bits (1079), Expect(2) = 0.0
 Identities = 192/207 (92%), Positives = 199/207 (96%)
 Frame = +1

Query: 619  LARKRNFTEKTPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKLQSLVKPSVDYVC 798
            LA+KRNFT KTPLMYEWYQEYYVGAAHGLAGIYY LMQPSLQVSH KL +LVKPSVDYVC
Sbjct: 193  LAQKRNFTAKTPLMYEWYQEYYVGAAHGLAGIYYLLMQPSLQVSHVKLHNLVKPSVDYVC 252

Query: 799  QLKFPSGNYPPCVDDTRDLLVHWCHGSPGVIYMLIQAYKVFREERYLNDAYQCADVIWKY 978
            QLKFPSGNYPPCVDD RDLLVHWCHGSPGVIYMLIQAYK FR E YLNDA+QCADVIW+Y
Sbjct: 253  QLKFPSGNYPPCVDDNRDLLVHWCHGSPGVIYMLIQAYKAFRGEHYLNDAHQCADVIWRY 312

Query: 979  GLLKKGYGLCHGTAGNAYAFLTLFNLTQDMKYLYRACKFAEWCLDYGEHGCRTPDTPFSL 1158
            GLL+KGYGLCHGTAGNAYAFLTL+NLTQDMKYLYRACKFAEWCLDYGEHGCRTPDTPFSL
Sbjct: 313  GLLRKGYGLCHGTAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLDYGEHGCRTPDTPFSL 372

Query: 1159 FEGMAGTIYFLADLLVPTKAKFPAFEL 1239
            FEGMAGTIYFLADLLVPTKA+FPAFEL
Sbjct: 373  FEGMAGTIYFLADLLVPTKARFPAFEL 399



 Score =  369 bits (947), Expect(2) = 0.0
 Identities = 178/194 (91%), Positives = 184/194 (94%)
 Frame = +3

Query: 39  MAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQQMERGLKSADPRDGT 218
           MAQRAFPNPYADFNKSLAE YFD AGRLTPEFSQR+NNKIRELLQQMERGLKSADPRD T
Sbjct: 1   MAQRAFPNPYADFNKSLAESYFDCAGRLTPEFSQRLNNKIRELLQQMERGLKSADPRDST 60

Query: 219 AYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSLNCLTKRSITFLCGDAGPLAVAAVV 398
            YTGWAGIA+LYLHLYDVFGDPAYLQMAHGY KQSLN LTKRSITFLCGDAGPLA+ AVV
Sbjct: 61  VYTGWAGIALLYLHLYDVFGDPAYLQMAHGYVKQSLNSLTKRSITFLCGDAGPLAIGAVV 120

Query: 399 HDKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRMGYIYALLFVNKNFGVEKIPRSHIQ 578
           + KMNNEKQAEDCITRLIHLNKID HAPNEMLYGRMGY+YALLFVNKNFGVEKIP+SHIQ
Sbjct: 121 YHKMNNEKQAEDCITRLIHLNKIDHHAPNEMLYGRMGYVYALLFVNKNFGVEKIPQSHIQ 180

Query: 579 QICETVLTSGENLA 620
           QICE VLTSGENLA
Sbjct: 181 QICEAVLTSGENLA 194


>ref|XP_540359.2| PREDICTED: similar to LanC-like protein 2 (Testis-specific adriamycin
            sensitivity protein) [Canis familiaris]
          Length = 452

 Score =  310 bits (794), Expect = 2e-84
 Identities = 134/207 (64%), Positives = 171/207 (82%)
 Frame = +1

Query: 619  LARKRNFTEKTPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKLQSLVKPSVDYVC 798
            L+R+    E+ PL+Y+W+++ YVGAAHG+AGIYY LMQP+ +V    L  +VKPS+DYV 
Sbjct: 237  LSREERKAERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVR 296

Query: 799  QLKFPSGNYPPCVDDTRDLLVHWCHGSPGVIYMLIQAYKVFREERYLNDAYQCADVIWKY 978
              +F SGNYP  + +  D LVHWCHG+PGVI+ML+QAYKVF+EE+YL DA +C+DVIW+ 
Sbjct: 297  HKRFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKDAMECSDVIWQR 356

Query: 979  GLLKKGYGLCHGTAGNAYAFLTLFNLTQDMKYLYRACKFAEWCLDYGEHGCRTPDTPFSL 1158
            GLL+KGYG+CHGTAGN Y+FL+L++LTQD KYLYRACKFAEWCL+YG HGCR PD P+SL
Sbjct: 357  GLLRKGYGICHGTAGNGYSFLSLYHLTQDKKYLYRACKFAEWCLEYGAHGCRIPDRPYSL 416

Query: 1159 FEGMAGTIYFLADLLVPTKAKFPAFEL 1239
            FEGMAG I+FL+D+L P  ++FPAFEL
Sbjct: 417  FEGMAGAIHFLSDILAPETSRFPAFEL 443



 Score =  169 bits (429), Expect = 4e-42
 Identities = 83/180 (46%), Positives = 122/180 (67%), Gaps = 4/180 (2%)
 Frame = +3

Query: 117 RLTPEFSQRVNNKIRELLQQMERGLKSADPRDGTAYTGWAGIAVLYLHLYDVFGDPAYLQ 296
           R+   F++R+  KI++LLQQME GLK+ADP D +AYTGW GIA+LYL LY V  D  YL 
Sbjct: 67  RIVQNFTKRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLL 126

Query: 297 MAHGYAKQSLNCLTKRSITFLCGDAGPLAVAAVVHDKMNNEKQAEDCITRLIHLNKI--- 467
            +  Y K++L  L  R +TFLCGDAGPLAV AVV+ K+ ++ ++++CIT+L+ L +    
Sbjct: 127 RSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDCESQECITKLLQLQRTIVC 186

Query: 468 -DPHAPNEMLYGRMGYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLAG*KKKLHR 644
            D   P+E+LYGR GY+YALL++N   G   +  S I+++   ++ SG+ L+  ++K  R
Sbjct: 187 RDSDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVCAIIESGKTLSREERKAER 246


>ref|XP_548943.2| PREDICTED: similar to LanC lantibiotic synthetase component C-like 3
            [Canis familiaris]
          Length = 420

 Score =  166 bits (421), Expect(2) = 8e-50
 Identities = 85/200 (42%), Positives = 130/200 (65%), Gaps = 4/200 (2%)
 Frame = +1

Query: 652  PLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKLQSLVKPSVDYVCQLKFPSGNYPP 831
            PLMY +Y   Y+GAAHGL+ I   L+     +  +  Q LV  SVD++ + +  + N+PP
Sbjct: 221  PLMYSYYGTEYLGAAHGLSSILQMLLSYHEHLKPSD-QELVWQSVDFLMEQE-QNCNWPP 278

Query: 832  CVDDT---RDLLVHWCHGSPGVIYMLIQAYKVFREERYLNDAYQCADVIWKYGLLKKGYG 1002
             + +     + LVHWCHG+PG+ Y+  +AY V ++ +YL+   +C ++ W+ GLLKKG G
Sbjct: 279  ELGEAIERENELVHWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLKKGPG 338

Query: 1003 LCHGTAGNAYAFLTLFNLTQDMKYLYRACKFAEWCL-DYGEHGCRTPDTPFSLFEGMAGT 1179
            +CHG AG+AY FL L+ LT + KY+YRA +FAE+   +  + G R  ++ +SL+EG +GT
Sbjct: 339  ICHGVAGSAYVFLLLYRLTGNSKYIYRAQRFAEFLFTEEFKAGSRVLESIYSLYEGFSGT 398

Query: 1180 IYFLADLLVPTKAKFPAFEL 1239
            + FL DLL P +A+FP F +
Sbjct: 399  VCFLIDLLQPNQAEFPLFSV 418



 Score = 50.4 bits (119), Expect(2) = 8e-50
 Identities = 52/223 (23%), Positives = 88/223 (39%), Gaps = 23/223 (10%)
 Frame = +3

Query: 36  MMAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQ-----QMERGLKSA 200
           M  +R F N + D+  SL  G  + A  + P  +  +   ++EL       +      +A
Sbjct: 1   MDTKRCFANRFDDYQGSLLAGQCEEA--VAPLVTATIERILQELPPLGGGAEARGAAAAA 58

Query: 201 DPRDGTAYTGWAGIAVLYLHLYDVFGDPAYLQMAHGY---AKQSLNCLTKRS-------- 347
               G  Y G AG+A +   LY V   P +      Y   AK+ ++   +          
Sbjct: 59  SSCQGGLYGGVAGVAYM---LYHVSQSPLFAGARERYLRSAKRLIDACARAEEWGEPDAD 115

Query: 348 --ITFLCGDAGPLAVAAVVHDKMNNEKQAED-----CITRLIHLNKIDPHAPNEMLYGRM 506
               FL G AG  AVA +V+  +      +       +  +           +E+  GR 
Sbjct: 116 TRAAFLLGGAGVYAVATLVYHALGRSDYVQPLGKFRALCAVCAPVSFLECGSDELFVGRA 175

Query: 507 GYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLAG*KKK 635
           GY+ A L + +    E +  + I+ IC+ +L SG+  A  K+K
Sbjct: 176 GYLCAALVLKQKLAQEVLTPAQIKSICQAILDSGKQYAMKKRK 218


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 51,870,440
Number of Sequences: 33732
Number of extensions: 1253765
Number of successful extensions: 3536
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 3224
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3528
length of database: 19,266,565
effective HSP length: 106
effective length of database: 15,690,973
effective search space used: 5382003739
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= THY01_0114_B04
         (1351 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_006046.1| lanthionine synthetase C-like protein 1 [Homo s...   418   0.0  
Alignment   gi|NP_061167.1| LanC lantibiotic synthetase component C-like 2 ...   311   8e-85
Alignment   gi|NP_940913.1| LanC lantibiotic synthetase component C-like 3 ...   130   3e-39

>ref|NP_006046.1| lanthionine synthetase C-like protein 1 [Homo sapiens]
          Length = 399

 Score =  418 bits (1074), Expect(2) = 0.0
 Identities = 191/207 (92%), Positives = 200/207 (96%)
 Frame = +1

Query: 619  LARKRNFTEKTPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKLQSLVKPSVDYVC 798
            LARKRNFT K+PLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVS  KL SLVKPSVDYVC
Sbjct: 193  LARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVC 252

Query: 799  QLKFPSGNYPPCVDDTRDLLVHWCHGSPGVIYMLIQAYKVFREERYLNDAYQCADVIWKY 978
            QLKFPSGNYPPC+ D RDLLVHWCHG+PGVIYMLIQAYKVFREE+YL DAYQCADVIW+Y
Sbjct: 253  QLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQY 312

Query: 979  GLLKKGYGLCHGTAGNAYAFLTLFNLTQDMKYLYRACKFAEWCLDYGEHGCRTPDTPFSL 1158
            GLLKKGYGLCHG+AGNAYAFLTL+NLTQDMKYLYRACKFAEWCL+YGEHGCRTPDTPFSL
Sbjct: 313  GLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSL 372

Query: 1159 FEGMAGTIYFLADLLVPTKAKFPAFEL 1239
            FEGMAGTIYFLADLLVPTKA+FPAFEL
Sbjct: 373  FEGMAGTIYFLADLLVPTKARFPAFEL 399



 Score =  379 bits (974), Expect(2) = 0.0
 Identities = 181/194 (93%), Positives = 190/194 (97%)
 Frame = +3

Query: 39  MAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQQMERGLKSADPRDGT 218
           MAQRAFPNPYAD+NKSLAEGYFD+AGRLTPEFSQR+ NKIRELLQQMERGLKSADPRDGT
Sbjct: 1   MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGT 60

Query: 219 AYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSLNCLTKRSITFLCGDAGPLAVAAVV 398
            YTGWAGIAVLYLHLYDVFGDPAYLQ+AHGY KQSLNCLTKRSITFLCGDAGPLAVAAV+
Sbjct: 61  GYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVL 120

Query: 399 HDKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRMGYIYALLFVNKNFGVEKIPRSHIQ 578
           + KMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGR+GYIYALLFVNKNFGVEKIP+SHIQ
Sbjct: 121 YHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQ 180

Query: 579 QICETVLTSGENLA 620
           QICET+LTSGENLA
Sbjct: 181 QICETILTSGENLA 194


>ref|NP_061167.1| LanC lantibiotic synthetase component C-like 2 [Homo sapiens]
          Length = 450

 Score =  311 bits (797), Expect = 8e-85
 Identities = 136/207 (65%), Positives = 171/207 (82%)
 Frame = +1

Query: 619  LARKRNFTEKTPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKLQSLVKPSVDYVC 798
            L+R+   TE+ PL+Y+W+++ YVGAAHG+AGIYY LMQP+ +V    L  +VKPS+DYV 
Sbjct: 238  LSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVR 297

Query: 799  QLKFPSGNYPPCVDDTRDLLVHWCHGSPGVIYMLIQAYKVFREERYLNDAYQCADVIWKY 978
              KF SGNYP  + +  D LVHWCHG+PGVI+ML+QAYKVF+EE+YL +A +C+DVIW+ 
Sbjct: 298  HKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQR 357

Query: 979  GLLKKGYGLCHGTAGNAYAFLTLFNLTQDMKYLYRACKFAEWCLDYGEHGCRTPDTPFSL 1158
            GLL+KGYG+CHGTAGN Y+FL+L+ LTQD KYLYRACKFAEWCLDYG HGCR PD P+SL
Sbjct: 358  GLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSL 417

Query: 1159 FEGMAGTIYFLADLLVPTKAKFPAFEL 1239
            FEGMAG I+FL+D+L P  ++FPAFEL
Sbjct: 418  FEGMAGAIHFLSDVLGPETSRFPAFEL 444



 Score =  172 bits (437), Expect = 5e-43
 Identities = 91/229 (39%), Positives = 137/229 (59%), Gaps = 27/229 (11%)
 Frame = +3

Query: 39  MAQRAFPNPYADFNKS----LAEGYFDSAGRLTP-------------------EFSQRVN 149
           M +RAF NP+ D+  +    LA G  +  G + P                    F +R+ 
Sbjct: 19  MEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATTDEPGLPFHQDGKIIHNFIRRIQ 78

Query: 150 NKIRELLQQMERGLKSADPRDGTAYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSLN 329
            KI++LLQQME GLK+ADP D +AYTGW GIA+LYL LY V  D  YL  +  Y K++L 
Sbjct: 79  TKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLR 138

Query: 330 CLTKRSITFLCGDAGPLAVAAVVHDKMNNEKQAEDCITRLIHLNKI----DPHAPNEMLY 497
            L  R +TFLCGDAGPLAV AV++ K+ ++ ++++C+T+L+ L +     +   P+E+LY
Sbjct: 139 NLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLY 198

Query: 498 GRMGYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLAG*KKKLHR 644
           GR GY+YALL++N   G   +  S I+++   ++ SG+ L+  ++K  R
Sbjct: 199 GRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTER 247


>ref|NP_940913.1| LanC lantibiotic synthetase component C-like 3 [Homo sapiens]
          Length = 388

 Score =  130 bits (326), Expect(2) = 3e-39
 Identities = 64/148 (43%), Positives = 97/148 (65%), Gaps = 3/148 (2%)
 Frame = +1

Query: 652  PLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKLQSLVKPSVDYVCQLKFPSGNYPP 831
            PLMY +Y   Y+GAAHGL+ I   L+     +  +  + LV  SVD++ + +  + N+PP
Sbjct: 221  PLMYSYYGTEYLGAAHGLSSILQMLLSYHEHLKPSD-RELVWQSVDFLMEQE-QNCNWPP 278

Query: 832  CVDDT---RDLLVHWCHGSPGVIYMLIQAYKVFREERYLNDAYQCADVIWKYGLLKKGYG 1002
             + +T    + LVHWCHG+PG+ Y+  +AY V ++ +YL+   +C ++ W+ GLLKKG G
Sbjct: 279  ELGETIERENELVHWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLKKGPG 338

Query: 1003 LCHGTAGNAYAFLTLFNLTQDMKYLYRA 1086
            +CHG AG+AY FL L+ LT + KY+YRA
Sbjct: 339  ICHGVAGSAYVFLLLYRLTGNSKYIYRA 366



 Score = 51.2 bits (121), Expect(2) = 3e-39
 Identities = 55/227 (24%), Positives = 89/227 (39%), Gaps = 27/227 (11%)
 Frame = +3

Query: 36  MMAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQQMERGLKSADPRDG 215
           M  +R F N + D+  SL  G  + A       +  V   I  +LQ++      A+ R  
Sbjct: 1   MDTKRCFANRFDDYQGSLLAGQCEEA------VAPLVTATIERILQELPPLGGGAEARGA 54

Query: 216 TA---------YTGWAGIAVLYLHLYDVFGDPAYLQMAHGY---AKQSLNCLTKRS---- 347
           TA         Y G AG+A +   LY V   P +      Y   AK+ ++   +      
Sbjct: 55  TAGASACQGGLYGGVAGVAYM---LYHVSQSPLFATARERYLRSAKRLIDACARAEEWGE 111

Query: 348 ------ITFLCGDAGPLAVAAVVHDKMNNEKQAED-----CITRLIHLNKIDPHAPNEML 494
                   FL G AG  AVA +V+  +      +       +  +           +E+ 
Sbjct: 112 PDADTRAAFLLGGAGVYAVATLVYHALGRSDYVQPLGKFRALCAVCAPVSFLECGSDELF 171

Query: 495 YGRMGYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLAG*KKK 635
            GR GY+ A L + +    E +  + I+ IC+ +L SG+  A  K+K
Sbjct: 172 VGRAGYLCAALVLKQKLAQEVLTPAQIKSICQAILDSGKQYAIKKRK 218


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 49,860,395
Number of Sequences: 39411
Number of extensions: 1235513
Number of successful extensions: 3328
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 3012
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3318
length of database: 17,774,539
effective HSP length: 105
effective length of database: 13,636,384
effective search space used: 4690916096
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= THY01_0114_B04
         (1351 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

 ***** No hits found ******

  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,218,282
Number of Sequences: 1040
Number of extensions: 29795
Number of successful extensions: 88
Number of sequences better than 1.0e-05: 0
Number of HSP's better than  0.0 without gapping: 78
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 88
length of database: 434,620
effective HSP length: 80
effective length of database: 351,420
effective search space used: 129673980
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= THY01_0114_B04
         (1351 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_067270.1| LanC (bacterial lantibiotic synthetase componen...   405   0.0  
Alignment   gi|NP_598498.1| LanC (bacterial lantibiotic synthetase componen...   309   4e-84
Alignment   gi|NP_775590.1| LanC lantibiotic synthetase component C-like 3 ...   168   1e-50
Alignment   gi|XP_984245.1| PREDICTED: similar to LanC (bacterial lantibiot...   183   4e-46

>ref|NP_067270.1| LanC (bacterial lantibiotic synthetase component C)-like 1 [Mus
            musculus]
          Length = 399

 Score =  405 bits (1041), Expect(2) = 0.0
 Identities = 185/207 (89%), Positives = 196/207 (94%)
 Frame = +1

Query: 619  LARKRNFTEKTPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKLQSLVKPSVDYVC 798
            L+RKRN   K+PLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQV+  KL SLVKPSVD+VC
Sbjct: 193  LSRKRNLAAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVNQGKLHSLVKPSVDFVC 252

Query: 799  QLKFPSGNYPPCVDDTRDLLVHWCHGSPGVIYMLIQAYKVFREERYLNDAYQCADVIWKY 978
            +LKFPSGNYPPC+DDTRDLLVHWCHG+PGVIYMLIQAYKVF+EERYL DA QCADVIW+Y
Sbjct: 253  RLKFPSGNYPPCLDDTRDLLVHWCHGAPGVIYMLIQAYKVFKEERYLCDAQQCADVIWQY 312

Query: 979  GLLKKGYGLCHGTAGNAYAFLTLFNLTQDMKYLYRACKFAEWCLDYGEHGCRTPDTPFSL 1158
            GLLKKGYGLCHG AGNAYAFL L+NLTQD+KYLYRACKFAEWCLDYGEHGCRT DTPFSL
Sbjct: 313  GLLKKGYGLCHGAAGNAYAFLALYNLTQDLKYLYRACKFAEWCLDYGEHGCRTADTPFSL 372

Query: 1159 FEGMAGTIYFLADLLVPTKAKFPAFEL 1239
            FEGMAGTIYFLADLLVPTKAKFPAFEL
Sbjct: 373  FEGMAGTIYFLADLLVPTKAKFPAFEL 399



 Score =  355 bits (911), Expect(2) = 0.0
 Identities = 168/194 (86%), Positives = 183/194 (94%)
 Frame = +3

Query: 39  MAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQQMERGLKSADPRDGT 218
           MAQRAFPNPYAD+NKSLAE YFDS GRLTPEFS R+ NKIRELLQQMERGLKSADPRDGT
Sbjct: 1   MAQRAFPNPYADYNKSLAENYFDSTGRLTPEFSHRLTNKIRELLQQMERGLKSADPRDGT 60

Query: 219 AYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSLNCLTKRSITFLCGDAGPLAVAAVV 398
            YTGWAGIAVLYLHL++VFGDPAYLQMAH Y KQSLNCL++RSITFLCGDAGPLAVAAV+
Sbjct: 61  GYTGWAGIAVLYLHLHNVFGDPAYLQMAHSYVKQSLNCLSRRSITFLCGDAGPLAVAAVL 120

Query: 399 HDKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRMGYIYALLFVNKNFGVEKIPRSHIQ 578
           + KMN+EKQAE+CITRLIHLNKIDPH PNEMLYGR+GYI+ALLFVNKNFG EKIP+SHIQ
Sbjct: 121 YHKMNSEKQAEECITRLIHLNKIDPHVPNEMLYGRIGYIFALLFVNKNFGEEKIPQSHIQ 180

Query: 579 QICETVLTSGENLA 620
           QICE +LTSGENL+
Sbjct: 181 QICENILTSGENLS 194


>ref|NP_598498.1| LanC (bacterial lantibiotic synthetase component C)-like 2 [Mus
            musculus]
          Length = 450

 Score =  309 bits (792), Expect = 4e-84
 Identities = 133/207 (64%), Positives = 171/207 (82%)
 Frame = +1

Query: 619  LARKRNFTEKTPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKLQSLVKPSVDYVC 798
            L+R+   +E+ PL+Y+W+++ YVGAAHG+AGIYY LMQP  +V    L  +VKPS+DYV 
Sbjct: 238  LSREERKSERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPEAKVDQETLTEMVKPSIDYVR 297

Query: 799  QLKFPSGNYPPCVDDTRDLLVHWCHGSPGVIYMLIQAYKVFREERYLNDAYQCADVIWKY 978
              KF SGNYP  + +  D LVHWCHG+PGVI++L+QAY+VF+EE+YL +A +C+DVIW+ 
Sbjct: 298  HKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHVLLQAYQVFKEEKYLKEAMECSDVIWQR 357

Query: 979  GLLKKGYGLCHGTAGNAYAFLTLFNLTQDMKYLYRACKFAEWCLDYGEHGCRTPDTPFSL 1158
            GLL+KGYG+CHGT+GN Y+FL+L+ LTQD KYLYRACKFAEWCLDYG HGCR PD P+SL
Sbjct: 358  GLLRKGYGICHGTSGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSL 417

Query: 1159 FEGMAGTIYFLADLLVPTKAKFPAFEL 1239
            FEGMAG ++FL+D+LVP  A+FPAFEL
Sbjct: 418  FEGMAGAVHFLSDILVPETARFPAFEL 444



 Score =  183 bits (464), Expect = 4e-46
 Identities = 93/230 (40%), Positives = 143/230 (62%), Gaps = 28/230 (12%)
 Frame = +3

Query: 39  MAQRAFPNPYADFNKS-----LAEGYFDSAGR-------------------LTPEFSQRV 146
           M +R+FPNP+ D+  +     LA G  +  GR                   + P F +R+
Sbjct: 18  MEERSFPNPFPDYEAAASAAGLAAGSAEETGRVCPLPTTEDPGLPFHPNGKIVPNFIKRI 77

Query: 147 NNKIRELLQQMERGLKSADPRDGTAYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSL 326
             KI++LLQQME GLK+ADP D +AYTGW GIA+LYL LY V GD  YL  +  Y K++L
Sbjct: 78  QTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTGDQTYLLRSLDYVKRTL 137

Query: 327 NCLTKRSITFLCGDAGPLAVAAVVHDKMNNEKQAEDCITRLIHLNKI----DPHAPNEML 494
             L+ R +TFLCGDAGPLAV AV++ K+ +E ++++CIT+L+ +++     +   P+E+L
Sbjct: 138 RNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLLQMHRTIVCQESELPDELL 197

Query: 495 YGRMGYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLAG*KKKLHR 644
           YGR GY+YALL++N   G   +  + I+++   ++ SG++L+  ++K  R
Sbjct: 198 YGRAGYLYALLYLNTEIGPGTVGETAIKEVVSAIIESGKSLSREERKSER 247


>ref|NP_775590.1| LanC lantibiotic synthetase component C-like 3 [Mus musculus]
          Length = 420

 Score =  168 bits (426), Expect(2) = 1e-50
 Identities = 86/202 (42%), Positives = 134/202 (66%), Gaps = 6/202 (2%)
 Frame = +1

Query: 652  PLMYEWYQEYYVGAAHGLAGIYYYLM--QPSLQVSHAKLQSLVKPSVDYVCQLKFPSGNY 825
            PLMY +Y   Y+GAAHGL+ I   L+  Q  L+ S    + LV+ SVD++ + +  + N+
Sbjct: 221  PLMYSYYGTEYLGAAHGLSSILQMLLSYQEHLKPSD---RELVRQSVDFLMEQE-QNCNW 276

Query: 826  PPCVDDT---RDLLVHWCHGSPGVIYMLIQAYKVFREERYLNDAYQCADVIWKYGLLKKG 996
            PP + +T    + LVHWCHG+PG+ Y+  +AY + ++ +YL+   +C ++ W+ GLLKKG
Sbjct: 277  PPELGETIERENELVHWCHGAPGIAYLFAKAYLISKKPQYLDTCIRCGELTWQKGLLKKG 336

Query: 997  YGLCHGTAGNAYAFLTLFNLTQDMKYLYRACKFAEWCL-DYGEHGCRTPDTPFSLFEGMA 1173
             G+CHG AG+AY FL L+ LT + KY+YRA +FA++   +  + G R  ++ +SL+EG +
Sbjct: 337  PGICHGVAGSAYVFLLLYRLTGNSKYIYRAQRFAQFLFTEEFKSGSRVLESIYSLYEGFS 396

Query: 1174 GTIYFLADLLVPTKAKFPAFEL 1239
            GT+ FL DLL P +A+FP F +
Sbjct: 397  GTVCFLIDLLQPNQAEFPLFSV 418



 Score = 51.2 bits (121), Expect(2) = 1e-50
 Identities = 56/227 (24%), Positives = 91/227 (40%), Gaps = 27/227 (11%)
 Frame = +3

Query: 36  MMAQRAFPNPYADFNKSLAEGYFDSAGRLTPEFSQRVNNKIRELLQQMERGLKSADPRDG 215
           M  +R F N + D+  SL  G  + A       +  V + I  +LQ++      A+ R  
Sbjct: 1   MDTKRCFANRFDDYQGSLLAGQCEEA------VAPLVTSTIERILQELPPLGGGAEARGA 54

Query: 216 TA---------YTGWAGIAVLYLHLYDVFGDPAYLQMAHGY---AKQSLN-CLTKRS--- 347
           T          Y+G AG+A +   LY V   P +      Y   AK+ ++ CL       
Sbjct: 55  TGAGSSCQGGLYSGVAGVAYM---LYHVSQSPLFAAARERYLRFAKRLIDACLRAEEWGE 111

Query: 348 ------ITFLCGDAGPLAVAAVVHDKMNNEKQAED-----CITRLIHLNKIDPHAPNEML 494
                   FL G AG  AVA +V+  +      +       +  +           +E+ 
Sbjct: 112 TDADTRAAFLLGGAGVYAVATLVYHALGRPDYVQPLGKFRALCAVCAPVSFLDCGSDELF 171

Query: 495 YGRMGYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLAG*KKK 635
            GR GY+ A L + +    E +  + I+ IC+ +L SG+  A  K+K
Sbjct: 172 VGRAGYLCAALVLKQKLAQEVLTPTQIKAICQAILDSGKQYALKKRK 218


>ref|XP_984245.1| PREDICTED: similar to LanC (bacterial lantibiotic synthetase
           component C)-like 2 [Mus musculus]
          Length = 390

 Score =  183 bits (464), Expect = 4e-46
 Identities = 93/230 (40%), Positives = 143/230 (62%), Gaps = 28/230 (12%)
 Frame = +3

Query: 39  MAQRAFPNPYADFNKS-----LAEGYFDSAGR-------------------LTPEFSQRV 146
           M +R+FPNP+ D+  +     LA G  +  GR                   + P F +R+
Sbjct: 18  MEERSFPNPFPDYEAAASAAGLAAGSAEETGRVCPLPTTEDPGLPFHPNGKIVPNFIKRI 77

Query: 147 NNKIRELLQQMERGLKSADPRDGTAYTGWAGIAVLYLHLYDVFGDPAYLQMAHGYAKQSL 326
             KI++LLQQME GLK+ADP D +AYTGW GIA+LYL LY V GD  YL  +  Y K++L
Sbjct: 78  QTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTGDQTYLLRSLDYVKRTL 137

Query: 327 NCLTKRSITFLCGDAGPLAVAAVVHDKMNNEKQAEDCITRLIHLNKI----DPHAPNEML 494
             L+ R +TFLCGDAGPLAV AV++ K+ +E ++++CIT+L+ +++     +   P+E+L
Sbjct: 138 RNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLLQMHRTIVCQESELPDELL 197

Query: 495 YGRMGYIYALLFVNKNFGVEKIPRSHIQQICETVLTSGENLAG*KKKLHR 644
           YGR GY+YALL++N   G   +  + I+++   ++ SG++L+  ++K  R
Sbjct: 198 YGRAGYLYALLYLNTEIGPGTVGETAIKEVVSAIIESGKSLSREERKSER 247



 Score =  128 bits (321), Expect = 2e-29
 Identities = 55/99 (55%), Positives = 75/99 (75%)
 Frame = +1

Query: 619 LARKRNFTEKTPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSHAKLQSLVKPSVDYVC 798
           L+R+   +E+ PL+Y+W+++ YVGAAHG+AGIYY LMQP  +V    L  +VKPS+DYV 
Sbjct: 238 LSREERKSERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPEAKVDQETLTEMVKPSIDYVR 297

Query: 799 QLKFPSGNYPPCVDDTRDLLVHWCHGSPGVIYMLIQAYK 915
             KF SGNYP  + +  D LVHWCHG+PGVI++L+QAY+
Sbjct: 298 HKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHVLLQAYQ 336


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 60,056,421
Number of Sequences: 45328
Number of extensions: 1463617
Number of successful extensions: 3893
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 3535
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3878
length of database: 21,768,885
effective HSP length: 107
effective length of database: 16,918,789
effective search space used: 5786225838
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)