Animal-Genome cDNA UTR01_0001_D08


Search to RefSeqBP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= UTR01_0001_D08
         (1079 letters)

Database: RefSeqBP 
           33,508 sequences; 16,112,626 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_001030273.1| thioredoxin-like [Bos taurus]                     254   8e-68
Alignment   gi|XP_873370.1| PREDICTED: similar to Thioredoxin-like protein ...    79   5e-15
Alignment   gi|NP_776393.1| thioredoxin [Bos taurus]                              52   6e-07
Alignment   gi|XP_586040.2| PREDICTED: similar to Thioredoxin-like protein ...    49   5e-06

>ref|NP_001030273.1| thioredoxin-like [Bos taurus]
          Length = 334

 Score =  254 bits (649), Expect = 8e-68
 Identities = 126/140 (90%), Positives = 126/140 (90%)
 Frame = +3

Query: 72  QFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY 251
           QFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEH QVSFVKLEAEAVPEVSEKY
Sbjct: 20  QFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHQQVSFVKLEAEAVPEVSEKY 79

Query: 252 GISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKL 431
            ISSVPTFLFFKNSQ IDRLDGAHAPELTKKVQRHA          EH KEDLSLRLKKL
Sbjct: 80  EISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFSPSGSEHPKEDLSLRLKKL 139

Query: 432 THAAPCMLFMKGTPQEPRCG 491
           THAAPCMLFMKGTPQEPRCG
Sbjct: 140 THAAPCMLFMKGTPQEPRCG 159


>ref|XP_873370.1| PREDICTED: similar to Thioredoxin-like protein 2 (PKC-interacting
           cousin of thioredoxin) (PKC-theta-interacting protein)
           (PKCq-interacting protein) (HUSSY-22) [Bos taurus]
          Length = 164

 Score = 79.3 bits (194), Expect = 5e-15
 Identities = 38/56 (67%), Positives = 42/56 (75%)
 Frame = +3

Query: 324 APELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKLTHAAPCMLFMKGTPQEPRCG 491
           APEL+KKVQ+HA          EHLKEDL+  LKKL  AAPC+LFMKGTPQEPRCG
Sbjct: 2   APELSKKVQQHASGGSFSPSGSEHLKEDLNQPLKKLFLAAPCILFMKGTPQEPRCG 57


>ref|NP_776393.1| thioredoxin [Bos taurus]
          Length = 105

 Score = 52.4 bits (124), Expect = 6e-07
 Identities = 24/87 (27%), Positives = 45/87 (51%)
 Frame = +3

Query: 75  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 254
           F+E L    + L+VV F A W   C  +      L++++  V F++++ +   +V+ +  
Sbjct: 11  FQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVDDCQDVAAECE 70

Query: 255 ISSVPTFLFFKNSQSIDRLDGAHAPEL 335
           +  +PTF FFK  Q +    GA+  +L
Sbjct: 71  VKCMPTFQFFKKGQKVGEFSGANKEKL 97


>ref|XP_586040.2| PREDICTED: similar to Thioredoxin-like protein 1 (32 kDa
           thioredoxin-related protein) [Bos taurus]
          Length = 467

 Score = 49.3 bits (116), Expect = 5e-06
 Identities = 21/70 (30%), Positives = 40/70 (57%)
 Frame = +3

Query: 147 CAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYGISSVPTFLFFKNSQSIDRLDGAHA 326
           C ++    + ++ ++PQ  F++++       +    IS+ PTFLFF+N   ID+  GA A
Sbjct: 215 CLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADA 274

Query: 327 PELTKKVQRH 356
             L +K+++H
Sbjct: 275 VGLEEKIKQH 284


  Database: RefSeqBP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 16,112,626
  Number of sequences in database:  33,508
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 38,261,772
Number of Sequences: 33508
Number of extensions: 1023306
Number of successful extensions: 3499
Number of sequences better than 1.0e-05: 4
Number of HSP's better than  0.0 without gapping: 3124
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3485
length of database: 16,112,626
effective HSP length: 103
effective length of database: 12,661,302
effective search space used: 3241293312
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqCP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= UTR01_0001_D08
         (1079 letters)

Database: RefSeqCP 
           33,732 sequences; 19,266,565 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|XP_535061.2| PREDICTED: similar to Thioredoxin-like 2 protei...   248   6e-66
Alignment   gi|XP_532029.2| PREDICTED: similar to Thioredoxin (ATL-derived ...    52   1e-06
Alignment   gi|XP_541090.2| PREDICTED: similar to Thioredoxin-like protein ...    49   6e-06

>ref|XP_535061.2| PREDICTED: similar to Thioredoxin-like 2 protein (PKC-interacting
           cousin of thioredoxin) (PKCq-interacting protein)
           (PKC-theta-interacting protein) [Canis familiaris]
          Length = 333

 Score =  248 bits (634), Expect = 6e-66
 Identities = 122/140 (87%), Positives = 124/140 (88%)
 Frame = +3

Query: 72  QFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY 251
           QFEELLRLRAKSL+VVHFWAPWAPQC QMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY
Sbjct: 19  QFEELLRLRAKSLVVVHFWAPWAPQCVQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY 78

Query: 252 GISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKL 431
            ISSVPTFL FKNSQ IDRLDGAHAPELTKKVQRHA          EH KEDL +RLKKL
Sbjct: 79  EISSVPTFLLFKNSQKIDRLDGAHAPELTKKVQRHASSGSFPPSTNEHPKEDLHVRLKKL 138

Query: 432 THAAPCMLFMKGTPQEPRCG 491
           THAAPCMLFMKGTPQEPRCG
Sbjct: 139 THAAPCMLFMKGTPQEPRCG 158


>ref|XP_532029.2| PREDICTED: similar to Thioredoxin (ATL-derived factor) (ADF)
           (Surface associated sulphydryl protein) (SASP) [Canis
           familiaris]
          Length = 219

 Score = 52.0 bits (123), Expect = 1e-06
 Identities = 24/87 (27%), Positives = 44/87 (50%)
 Frame = +3

Query: 75  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 254
           F+E L      L+VV F A W   C  +      L++++  V F++++ +   +V+ +  
Sbjct: 125 FQEALNSAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVDDCQDVASECE 184

Query: 255 ISSVPTFLFFKNSQSIDRLDGAHAPEL 335
           +  +PTF FFK  Q +    GA+  +L
Sbjct: 185 VKCMPTFQFFKKGQKVGEFSGANKEKL 211


>ref|XP_541090.2| PREDICTED: similar to Thioredoxin-like protein 1 (32 kDa
           thioredoxin-related protein) [Canis familiaris]
          Length = 267

 Score = 49.3 bits (116), Expect = 6e-06
 Identities = 21/70 (30%), Positives = 40/70 (57%)
 Frame = +3

Query: 147 CAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYGISSVPTFLFFKNSQSIDRLDGAHA 326
           C ++    + ++ ++PQ  F++++       +    IS+ PTFLFF+N   ID+  GA A
Sbjct: 12  CLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADA 71

Query: 327 PELTKKVQRH 356
             L +K+++H
Sbjct: 72  VGLEEKIKQH 81


  Database: RefSeqCP
    Posted date:  Aug 1, 2006  9:25 PM
  Number of letters in database: 19,266,565
  Number of sequences in database:  33,732
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 44,782,187
Number of Sequences: 33732
Number of extensions: 1191939
Number of successful extensions: 4078
Number of sequences better than 1.0e-05: 3
Number of HSP's better than  0.0 without gapping: 3495
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4059
length of database: 19,266,565
effective HSP length: 104
effective length of database: 15,758,437
effective search space used: 4018401435
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqHP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= UTR01_0001_D08
         (1079 letters)

Database: RefSeqHP 
           39,411 sequences; 17,774,539 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_006532.2| thioredoxin-like [Homo sapiens]                      250   2e-66
Alignment   gi|XP_947255.1| PREDICTED: similar to Thioredoxin domain-contai...    53   5e-07
Alignment   gi|XP_950856.1| PREDICTED: similar to thioredoxin domain-contai...    53   5e-07
Alignment   gi|XP_950855.1| PREDICTED: similar to thioredoxin domain-contai...    53   5e-07
Alignment   gi|NP_115619.4| thioredoxin domain-containing 2 [Homo sapiens]        53   5e-07
Alignment   gi|NP_004777.1| thioredoxin-like 1 [Homo sapiens]                     52   9e-07
Alignment   gi|NP_003320.2| thioredoxin [Homo sapiens]                            52   1e-06
Alignment   gi|NP_006840.2| protein disulfide isomerase-associated 2 [Homo ...    49   1e-05

>ref|NP_006532.2| thioredoxin-like [Homo sapiens]
          Length = 335

 Score =  250 bits (638), Expect = 2e-66
 Identities = 123/140 (87%), Positives = 126/140 (90%)
 Frame = +3

Query: 72  QFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY 251
           QFEELLRL+AKSLLVVHFWAPWAPQCAQMN+VMAELAKE PQVSFVKLEAE VPEVSEKY
Sbjct: 21  QFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKY 80

Query: 252 GISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKL 431
            ISSVPTFLFFKNSQ IDRLDGAHAPELTKKVQRHA          EHLKEDL+LRLKKL
Sbjct: 81  EISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKL 140

Query: 432 THAAPCMLFMKGTPQEPRCG 491
           THAAPCMLFMKGTPQEPRCG
Sbjct: 141 THAAPCMLFMKGTPQEPRCG 160


>ref|XP_947255.1| PREDICTED: similar to Thioredoxin domain-containing protein 2
           (Spermatid-specific thioredoxin-1) (Sptrx-1) isoform 1
           [Homo sapiens]
          Length = 538

 Score = 52.8 bits (125), Expect = 5e-07
 Identities = 27/82 (32%), Positives = 42/82 (51%)
 Frame = +3

Query: 75  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 254
           FE  L+   + L+ V F A W   C  +      L+ +H  V F++++A+   EV  +  
Sbjct: 444 FEASLKEAGERLVAVDFSATWCGPCRTIRPFFHALSVKHEDVVFLEVDADNCEEVVRECA 503

Query: 255 ISSVPTFLFFKNSQSIDRLDGA 320
           I  VPTF F+K  + +D L GA
Sbjct: 504 IMCVPTFQFYKKEEKVDELCGA 525


>ref|XP_950856.1| PREDICTED: similar to thioredoxin domain-containing 2 isoform 3
           [Homo sapiens]
          Length = 471

 Score = 52.8 bits (125), Expect = 5e-07
 Identities = 27/82 (32%), Positives = 42/82 (51%)
 Frame = +3

Query: 75  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 254
           FE  L+   + L+ V F A W   C  +      L+ +H  V F++++A+   EV  +  
Sbjct: 377 FEASLKEAGERLVAVDFSATWCGPCRTIRPFFHALSVKHEDVVFLEVDADNCEEVVRECA 436

Query: 255 ISSVPTFLFFKNSQSIDRLDGA 320
           I  VPTF F+K  + +D L GA
Sbjct: 437 IMCVPTFQFYKKEEKVDELCGA 458


>ref|XP_950855.1| PREDICTED: similar to thioredoxin domain-containing 2 isoform 2
           [Homo sapiens]
          Length = 471

 Score = 52.8 bits (125), Expect = 5e-07
 Identities = 27/82 (32%), Positives = 42/82 (51%)
 Frame = +3

Query: 75  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 254
           FE  L+   + L+ V F A W   C  +      L+ +H  V F++++A+   EV  +  
Sbjct: 377 FEASLKEAGERLVAVDFSATWCGPCRTIRPFFHALSVKHEDVVFLEVDADNCEEVVRECA 436

Query: 255 ISSVPTFLFFKNSQSIDRLDGA 320
           I  VPTF F+K  + +D L GA
Sbjct: 437 IMCVPTFQFYKKEEKVDELCGA 458


>ref|NP_115619.4| thioredoxin domain-containing 2 [Homo sapiens]
          Length = 486

 Score = 52.8 bits (125), Expect = 5e-07
 Identities = 27/82 (32%), Positives = 42/82 (51%)
 Frame = +3

Query: 75  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 254
           FE  L+   + L+ V F A W   C  +      L+ +H  V F++++A+   EV  +  
Sbjct: 392 FEASLKEAGERLVAVDFSATWCGPCRTIRPFFHALSVKHEDVVFLEVDADNCEEVVRECA 451

Query: 255 ISSVPTFLFFKNSQSIDRLDGA 320
           I  VPTF F+K  + +D L GA
Sbjct: 452 IMCVPTFQFYKKEEKVDELCGA 473


>ref|NP_004777.1| thioredoxin-like 1 [Homo sapiens]
          Length = 289

 Score = 52.0 bits (123), Expect = 9e-07
 Identities = 27/94 (28%), Positives = 47/94 (50%)
 Frame = +3

Query: 75  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 254
           F+  L      L VV F       C ++    + ++ ++PQ  F++++       +    
Sbjct: 13  FQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNN 72

Query: 255 ISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRH 356
           IS+ PTFLFF+N   ID+  GA A  L +K+++H
Sbjct: 73  ISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQH 106


>ref|NP_003320.2| thioredoxin [Homo sapiens]
          Length = 105

 Score = 51.6 bits (122), Expect = 1e-06
 Identities = 24/87 (27%), Positives = 44/87 (50%)
 Frame = +3

Query: 75  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 254
           F+E L      L+VV F A W   C  +      L++++  V F++++ +   +V+ +  
Sbjct: 11  FQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECE 70

Query: 255 ISSVPTFLFFKNSQSIDRLDGAHAPEL 335
           +  +PTF FFK  Q +    GA+  +L
Sbjct: 71  VKCMPTFQFFKKGQKVGEFSGANKEKL 97


>ref|NP_006840.2| protein disulfide isomerase-associated 2 [Homo sapiens]
          Length = 525

 Score = 48.5 bits (114), Expect = 1e-05
 Identities = 25/72 (34%), Positives = 39/72 (54%), Gaps = 4/72 (5%)
 Frame = +3

Query: 87  LRLRAKSLLVVHFWAPWAPQCAQM----NDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 254
           L LR    L+V F+APW   C  +    +   A LA E   V+  K++  A  E++E++G
Sbjct: 54  LALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMVVTLAKVDGPAQRELAEEFG 113

Query: 255 ISSVPTFLFFKN 290
           ++  PT  FF+N
Sbjct: 114 VTEYPTLKFFRN 125


  Database: RefSeqHP
    Posted date:  Aug 2, 2006 12:57 AM
  Number of letters in database: 17,774,539
  Number of sequences in database:  39,411
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 43,515,461
Number of Sequences: 39411
Number of extensions: 1203339
Number of successful extensions: 4210
Number of sequences better than 1.0e-05: 8
Number of HSP's better than  0.0 without gapping: 3544
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4198
length of database: 17,774,539
effective HSP length: 103
effective length of database: 13,715,206
effective search space used: 3511092736
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqSP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= UTR01_0001_D08
         (1079 letters)

Database: RefSeqSP 
           1040 sequences; 434,620 total letters

Searching...done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_999478.1| thioredoxin [Sus scrofa]                              53   1e-08

>ref|NP_999478.1| thioredoxin [Sus scrofa]
          Length = 105

 Score = 52.8 bits (125), Expect = 1e-08
 Identities = 24/87 (27%), Positives = 45/87 (51%)
 Frame = +3

Query: 75  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 254
           F+E L    + L+VV F A W   C  +      L++++  V F++++ +   +V+ +  
Sbjct: 11  FQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVDDCQDVASECE 70

Query: 255 ISSVPTFLFFKNSQSIDRLDGAHAPEL 335
           +  +PTF FFK  Q +    GA+  +L
Sbjct: 71  VKCMPTFQFFKKGQKVGEFSGANKEKL 97


  Database: RefSeqSP
    Posted date:  Aug 1, 2006  7:14 PM
  Number of letters in database: 434,620
  Number of sequences in database:  1040
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,021,905
Number of Sequences: 1040
Number of extensions: 26230
Number of successful extensions: 79
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 69
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 79
length of database: 434,620
effective HSP length: 78
effective length of database: 353,500
effective search space used: 99333500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Search to RefSeqMP

BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= UTR01_0001_D08
         (1079 letters)

Database: RefSeqMP 
           45,328 sequences; 21,768,885 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Alignment   gi|NP_075629.2| thioredoxin-like 2 [Mus musculus]                    251   9e-67
Alignment   gi|XP_995522.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   182   7e-46
Alignment   gi|XP_978406.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   182   7e-46
Alignment   gi|XP_978323.1| PREDICTED: similar to thioredoxin-like 2 [Mus m...   182   7e-46
Alignment   gi|NP_705739.1| thioredoxin domain containing 2 (spermatozoa) [...    56   7e-08
Alignment   gi|NP_058072.2| thioredoxin-like 1 [Mus musculus]                     52   1e-06
Alignment   gi|NP_035790.1| thioredoxin 1 [Mus musculus]                          51   2e-06

>ref|NP_075629.2| thioredoxin-like 2 [Mus musculus]
          Length = 337

 Score =  251 bits (641), Expect = 9e-67
 Identities = 122/140 (87%), Positives = 124/140 (88%)
 Frame = +3

Query: 72  QFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY 251
           QFEELLRL+ KSLLVVHFWAPWAPQC QMNDVMAELAKEHP VSFVKLEAEAVPEVSEKY
Sbjct: 23  QFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVSEKY 82

Query: 252 GISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKL 431
            ISSVPTFLFFKNSQ +DRLDGAHAPELTKKVQRH           EHLKEDLSLRLKKL
Sbjct: 83  EISSVPTFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGAFPPSTNEHLKEDLSLRLKKL 142

Query: 432 THAAPCMLFMKGTPQEPRCG 491
           THAAPCMLFMKGTPQEPRCG
Sbjct: 143 THAAPCMLFMKGTPQEPRCG 162


>ref|XP_995522.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  182 bits (461), Expect = 7e-46
 Identities = 91/125 (72%), Positives = 96/125 (76%)
 Frame = +3

Query: 72  QFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY 251
           QFEELLRL+ KSLLVVHFWAPWAPQC QMNDVMAELAKEHP VSFVKLEAEAVPEVSEKY
Sbjct: 51  QFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVSEKY 110

Query: 252 GISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKL 431
            ISSVP+FLFFKNSQ +DRLDGAHAPELTKKVQRH             LK+  +   K  
Sbjct: 111 EISSVPSFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGAFRLVLMNILKKTSAFAXKSX 170

Query: 432 THAAP 446
               P
Sbjct: 171 LTLPP 175


>ref|XP_978406.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  182 bits (461), Expect = 7e-46
 Identities = 91/125 (72%), Positives = 96/125 (76%)
 Frame = +3

Query: 72  QFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY 251
           QFEELLRL+ KSLLVVHFWAPWAPQC QMNDVMAELAKEHP VSFVKLEAEAVPEVSEKY
Sbjct: 51  QFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVSEKY 110

Query: 252 GISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKL 431
            ISSVP+FLFFKNSQ +DRLDGAHAPELTKKVQRH             LK+  +   K  
Sbjct: 111 EISSVPSFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGAFRLVLMNILKKTSAFAXKSX 170

Query: 432 THAAP 446
               P
Sbjct: 171 LTLPP 175


>ref|XP_978323.1| PREDICTED: similar to thioredoxin-like 2 [Mus musculus]
          Length = 365

 Score =  182 bits (461), Expect = 7e-46
 Identities = 91/125 (72%), Positives = 96/125 (76%)
 Frame = +3

Query: 72  QFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY 251
           QFEELLRL+ KSLLVVHFWAPWAPQC QMNDVMAELAKEHP VSFVKLEAEAVPEVSEKY
Sbjct: 51  QFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVSEKY 110

Query: 252 GISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHAXXXXXXXXXXEHLKEDLSLRLKKL 431
            ISSVP+FLFFKNSQ +DRLDGAHAPELTKKVQRH             LK+  +   K  
Sbjct: 111 EISSVPSFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGAFRLVLMNILKKTSAFAXKSX 170

Query: 432 THAAP 446
               P
Sbjct: 171 LTLPP 175


>ref|NP_705739.1| thioredoxin domain containing 2 (spermatozoa) [Mus musculus]
          Length = 462

 Score = 55.8 bits (133), Expect = 7e-08
 Identities = 26/92 (28%), Positives = 48/92 (52%)
 Frame = +3

Query: 72  QFEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKY 251
           +FEE+L+   + L+ V F A W   C  M  +   L+ +H  V F++++ E   ++ +  
Sbjct: 367 EFEEVLKDAGEKLVAVDFSAAWCGPCRMMKPLFHSLSLKHEDVIFLEVDTEDCEQLVQDC 426

Query: 252 GISSVPTFLFFKNSQSIDRLDGAHAPELTKKV 347
            I  +PTF F+KN + +    GA   +L + +
Sbjct: 427 EIFHLPTFQFYKNEEKVGEFSGALVGKLERSI 458


>ref|NP_058072.2| thioredoxin-like 1 [Mus musculus]
          Length = 289

 Score = 52.0 bits (123), Expect = 1e-06
 Identities = 27/94 (28%), Positives = 47/94 (50%)
 Frame = +3

Query: 75  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 254
           F+  L      L VV F       C ++    + ++ ++PQ  F++++       +    
Sbjct: 13  FQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNN 72

Query: 255 ISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRH 356
           IS+ PTFLFF+N   ID+  GA A  L +K+++H
Sbjct: 73  ISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQH 106


>ref|NP_035790.1| thioredoxin 1 [Mus musculus]
          Length = 105

 Score = 50.8 bits (120), Expect = 2e-06
 Identities = 24/95 (25%), Positives = 44/95 (46%)
 Frame = +3

Query: 75  FEELLRLRAKSLLVVHFWAPWAPQCAQMNDVMAELAKEHPQVSFVKLEAEAVPEVSEKYG 254
           F+E L      L+VV F A W   C  +      L  ++  V F++++ +   +V+    
Sbjct: 11  FQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYSNVVFLEVDVDDCQDVAADCE 70

Query: 255 ISSVPTFLFFKNSQSIDRLDGAHAPELTKKVQRHA 359
           +  +PTF F+K  Q +    GA+  +L   +  +A
Sbjct: 71  VKCMPTFQFYKKGQKVGEFSGANKEKLEASITEYA 105


  Database: RefSeqMP
    Posted date:  Aug 2, 2006 12:58 AM
  Number of letters in database: 21,768,885
  Number of sequences in database:  45,328
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 51,421,042
Number of Sequences: 45328
Number of extensions: 1372637
Number of successful extensions: 4952
Number of sequences better than 1.0e-05: 7
Number of HSP's better than  0.0 without gapping: 4243
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4935
length of database: 21,768,885
effective HSP length: 105
effective length of database: 17,009,445
effective search space used: 4320399030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)